(data stored in ACNUC7421 zone)

EMBL: CP001700.PE479

CP001700.PE479       Location/Qualifiers
FT   CDS             complement(549102..550478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0482"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lxx:Lxx06835 major facilitator superfamily H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69434"
FT                   /db_xref="GOA:C7PX83"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX83"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69434.1"
FT                   /translation="MERGARVDGDSVPAESAGSGAAAPAERRAPEPKPEPEPEPADKRS
FT                   VLRDHDFRALLASKSASTVASAVTWVVLPLYVYTVSRSSLLTAVASAMNVIPYVLFGIV
FT                   AGALVDRSSPRRVMIVVELGNAAIMLTVPALHAGHVLSIAVLCAVGFTSATAFVWFDVA
FT                   SSTLVPSVVGKTAVFHANGFLWSVATLVQAVAAPTGFFLLNRWGIGWTFAALSLFYALS
FT                   ALFLAMVRMPSAASGGVAAGAPASAGGPGRAMLEGLQFIVREPTIRLLTIIGMGSGISA
FT                   GAVYGMIVVFANRALHLGTDDYRISWILAASSAGALLASFAAPRLRGLPPIPSVAGLLV
FT                   VDTVLMAGYALSADWQMALGAILLWNLAHTTLMIVSISLRQVLAPPRLQGRVNAAGKML
FT                   AWGSVPLGSALCGALTGWIGSRQASLLLVAPIAASLVLAAAMVVRRPAVTDPSKASESP
FT                   "
     MERGARVDGD SVPAESAGSG AAAPAERRAP EPKPEPEPEP ADKRSVLRDH DFRALLASKS        60
     ASTVASAVTW VVLPLYVYTV SRSSLLTAVA SAMNVIPYVL FGIVAGALVD RSSPRRVMIV       120
     VELGNAAIML TVPALHAGHV LSIAVLCAVG FTSATAFVWF DVASSTLVPS VVGKTAVFHA       180
     NGFLWSVATL VQAVAAPTGF FLLNRWGIGW TFAALSLFYA LSALFLAMVR MPSAASGGVA       240
     AGAPASAGGP GRAMLEGLQF IVREPTIRLL TIIGMGSGIS AGAVYGMIVV FANRALHLGT       300
     DDYRISWILA ASSAGALLAS FAAPRLRGLP PIPSVAGLLV VDTVLMAGYA LSADWQMALG       360
     AILLWNLAHT TLMIVSISLR QVLAPPRLQG RVNAAGKMLA WGSVPLGSAL CGALTGWIGS       420
     RQASLLLVAP IAASLVLAAA MVVRRPAVTD PSKASESP                               458
//

If you have problems or comments...

PBIL Back to PBIL home page