(data stored in ACNUC7421 zone)

EMBL: CP001700.PE48

CP001700.PE48        Location/Qualifiers
FT   CDS             complement(49198..49590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR4"
FT                   /inference="similar to AA sequence:KEGG:SGR_3310"
FT                   /protein_id="ACU69003.1"
FT                   /translation="MRRRRPRDAGYATVEAALAIPSLVLFTVALAGILTGLATQIRCVD
FT                   AARLGARAAARGEPAAQIQGAVTQAAPGSSIHITTENGLIHVSVAAPVAAMPLLRAFTV
FT                   HAEAYEADEATLEGGEEPHAAAEPRP"
     MRRRRPRDAG YATVEAALAI PSLVLFTVAL AGILTGLATQ IRCVDAARLG ARAAARGEPA        60
     AQIQGAVTQA APGSSIHITT ENGLIHVSVA APVAAMPLLR AFTVHAEAYE ADEATLEGGE       120
     EPHAAAEPRP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page