(data stored in ACNUC7421 zone)

EMBL: CP001700.PE481

CP001700.PE481       Location/Qualifiers
FT   CDS             complement(550952..552922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0484"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; WD40 domain protein beta Propeller;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69436"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX85"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69436.1"
FT                   /translation="MPEFRKSVTTIAVAAGSLSAVLGMSSAAQADSRSAAAAVSAVAPL
FT                   PGTGLPAVSNGPIYIQGPSGGGFMPVGGGNPVVCDAYASVMAWSPDGSRIACLEAYSAG
FT                   VLRIRNPDDNRVVSAGSVTDYAKPDSPLAKISSLTWFNHGREVVLAQNGSLISVRVDGS
FT                   QPRNPDNSYAPTAMLPGQTGITDVTANAAGTVLAFTQGTSTGASVIVYDTTKPAASALR
FT                   PLAQVSYASQLALSPDGRYLAYVPYTPGQNAPSQIWLYDLKSPASASNPRQVTSDSAVS
FT                   ASNPTWAPDGTRLAFTATSASLAHSVKSFPVADPSSQRVEVPTLTYQSFLWRPLTHKPV
FT                   ERLAGGDRVGTAVATSQSEWEGFGGASTGRRTAKSVTLSRSDLFADALGGAGFAAHQQG
FT                   PLLLTDPKHMDQATMTELRRVLGPGSGPNGPTVYLLGGDSALSPDVQKALVAANYHVER
FT                   IGGANRFDTAVKIAQRDSGTKPSKVLVATGIDYPDALAAGAAAGANANAVVVLTNDKKM
FT                   PPETAAYLNSVAGATVYGVGGQAVAALGNRPQTALKGTDRVATSLLVARNLFDTPGSVG
FT                   FATSMNWPDSLAGGALQGTVGGPLILVAPTTGLSADEQQWLTQSATAINSVQIYGGRAA
FT                   VPAIEAQVGTDIGGVGGFVVK"
     MPEFRKSVTT IAVAAGSLSA VLGMSSAAQA DSRSAAAAVS AVAPLPGTGL PAVSNGPIYI        60
     QGPSGGGFMP VGGGNPVVCD AYASVMAWSP DGSRIACLEA YSAGVLRIRN PDDNRVVSAG       120
     SVTDYAKPDS PLAKISSLTW FNHGREVVLA QNGSLISVRV DGSQPRNPDN SYAPTAMLPG       180
     QTGITDVTAN AAGTVLAFTQ GTSTGASVIV YDTTKPAASA LRPLAQVSYA SQLALSPDGR       240
     YLAYVPYTPG QNAPSQIWLY DLKSPASASN PRQVTSDSAV SASNPTWAPD GTRLAFTATS       300
     ASLAHSVKSF PVADPSSQRV EVPTLTYQSF LWRPLTHKPV ERLAGGDRVG TAVATSQSEW       360
     EGFGGASTGR RTAKSVTLSR SDLFADALGG AGFAAHQQGP LLLTDPKHMD QATMTELRRV       420
     LGPGSGPNGP TVYLLGGDSA LSPDVQKALV AANYHVERIG GANRFDTAVK IAQRDSGTKP       480
     SKVLVATGID YPDALAAGAA AGANANAVVV LTNDKKMPPE TAAYLNSVAG ATVYGVGGQA       540
     VAALGNRPQT ALKGTDRVAT SLLVARNLFD TPGSVGFATS MNWPDSLAGG ALQGTVGGPL       600
     ILVAPTTGLS ADEQQWLTQS ATAINSVQIY GGRAAVPAIE AQVGTDIGGV GGFVVK           656
//

If you have problems or comments...

PBIL Back to PBIL home page