(data stored in ACNUC7421 zone)

EMBL: CP001700.PE482

CP001700.PE482       Location/Qualifiers
FT   CDS             complement(553873..556104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: paa:Paes_2382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69437"
FT                   /db_xref="GOA:C7PX86"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69437.1"
FT                   /translation="MRDFTVLSDREFEELVADLLQARFGTHVERFPPGRDGGVDLRWRS
FT                   GAETVIGQCKHYARSGYSALLRELRRETKKVAKRKPDDYWVVTSVDLTSHRKDEIHGLF
FT                   QPWMRSSANVLGPLDLDGMLTEFTAVERRHVKLLFSTGEQLTALVHSGIVNRTQALLKR
FT                   IERARPAYAVTDAHRRAAELLEKHRVCVLVGPPGIGKTSLGMMLVAQAIGDGCQPVEVS
FT                   EDIDDAFAMLRAGEKQIFFYDDFLGELSYGERWGRKNEQKRIGHFIDHVAQSSSALLVM
FT                   TSREYILRDAGRMLETVRRVAAEPFVLRLAEIPPPDSGRVLYNHLWHAGLPDTARHDLA
FT                   GSGWTRIAGHHGFNPRVVEWCVQPEFVGDGGRYVSRVVDALDNPETIWETVFNGLPEFD
FT                   RLVLYVLSTLHGRFSTVEWASTVLDALCRETGLRFTGDDLRRALDVLEGTFTRIELVTH
FT                   WSSGEQEAVREVRFMNPSIRAFVLGRIAADVFACRAVLRTATDLNALELLWFGDEQGLM
FT                   DGLRLWPSRLSPQVRAEFVAAAQRLTDRSQRYYRAILFWNCMPHEWLPDRAWLTRAMEA
FT                   HIVELAADDEEDTIDPFTYNVVLRDLAGTDVGMRLHACVDAKTDVDRFENYLDDWDRLA
FT                   EHIRIHRRSCDLAGSAKVLESYEGFVDGELERMRETSGGPDIENLLQMASIAGILGLPG
FT                   LMQRLRDAVQLVRTSDGDGYPQQVAESIQVSWGTDLVQDFDRLLRPEHS"
     MRDFTVLSDR EFEELVADLL QARFGTHVER FPPGRDGGVD LRWRSGAETV IGQCKHYARS        60
     GYSALLRELR RETKKVAKRK PDDYWVVTSV DLTSHRKDEI HGLFQPWMRS SANVLGPLDL       120
     DGMLTEFTAV ERRHVKLLFS TGEQLTALVH SGIVNRTQAL LKRIERARPA YAVTDAHRRA       180
     AELLEKHRVC VLVGPPGIGK TSLGMMLVAQ AIGDGCQPVE VSEDIDDAFA MLRAGEKQIF       240
     FYDDFLGELS YGERWGRKNE QKRIGHFIDH VAQSSSALLV MTSREYILRD AGRMLETVRR       300
     VAAEPFVLRL AEIPPPDSGR VLYNHLWHAG LPDTARHDLA GSGWTRIAGH HGFNPRVVEW       360
     CVQPEFVGDG GRYVSRVVDA LDNPETIWET VFNGLPEFDR LVLYVLSTLH GRFSTVEWAS       420
     TVLDALCRET GLRFTGDDLR RALDVLEGTF TRIELVTHWS SGEQEAVREV RFMNPSIRAF       480
     VLGRIAADVF ACRAVLRTAT DLNALELLWF GDEQGLMDGL RLWPSRLSPQ VRAEFVAAAQ       540
     RLTDRSQRYY RAILFWNCMP HEWLPDRAWL TRAMEAHIVE LAADDEEDTI DPFTYNVVLR       600
     DLAGTDVGMR LHACVDAKTD VDRFENYLDD WDRLAEHIRI HRRSCDLAGS AKVLESYEGF       660
     VDGELERMRE TSGGPDIENL LQMASIAGIL GLPGLMQRLR DAVQLVRTSD GDGYPQQVAE       720
     SIQVSWGTDL VQDFDRLLRP EHS                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page