(data stored in ACNUC7421 zone)

EMBL: CP001700.PE483

CP001700.PE483       Location/Qualifiers
FT   CDS             complement(556566..557876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69438"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX87"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1081"
FT                   /protein_id="ACU69438.1"
FT                   /translation="MAGPDVPTDRVDHNRLRRLLGAPELAWLVDRVVERLAAGTTAADG
FT                   AVALTDPSPEQRRAVERLLGRPPGRGRTLTIRLGDVEAVLRDAEISPDGLAAAVTALRG
FT                   PIPVRHETAAAERTAWDSAHEPLEHLVAVRPDLAPWLRHVRATGLLKRHAPTSGTALDL
FT                   AGQAARVLAALPHPGTVRPILAAGAVGDAHALDDGRPLTALVLSAIRSLSGLAAADTTH
FT                   AEGRRAAWAGVGVATDHLSSRVLVLNVPPPPGDDSTLSRLLRLMATDGEPVTLTLRQLR
FT                   ALPAGHADLAGQTVSVCENPAVISAAADALGAACPPLLCLEGTPSVAAISLLRWILGRG
FT                   ARVRYHGDFDSGGIRIAVQVFALAARAGVPAVPWRYDSAAYLDAVALGLGSPLSAPVSP
FT                   DAPWDPDLRHHLETNAVRVEEEHVVDMLLGDLACGDC"
     MAGPDVPTDR VDHNRLRRLL GAPELAWLVD RVVERLAAGT TAADGAVALT DPSPEQRRAV        60
     ERLLGRPPGR GRTLTIRLGD VEAVLRDAEI SPDGLAAAVT ALRGPIPVRH ETAAAERTAW       120
     DSAHEPLEHL VAVRPDLAPW LRHVRATGLL KRHAPTSGTA LDLAGQAARV LAALPHPGTV       180
     RPILAAGAVG DAHALDDGRP LTALVLSAIR SLSGLAAADT THAEGRRAAW AGVGVATDHL       240
     SSRVLVLNVP PPPGDDSTLS RLLRLMATDG EPVTLTLRQL RALPAGHADL AGQTVSVCEN       300
     PAVISAAADA LGAACPPLLC LEGTPSVAAI SLLRWILGRG ARVRYHGDFD SGGIRIAVQV       360
     FALAARAGVP AVPWRYDSAA YLDAVALGLG SPLSAPVSPD APWDPDLRHH LETNAVRVEE       420
     EHVVDMLLGD LACGDC                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page