(data stored in ACNUC7421 zone)

EMBL: CP001700.PE484

CP001700.PE484       Location/Qualifiers
FT   CDS             complement(557882..562102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69439"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX88"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1082"
FT                   /protein_id="ACU69439.1"
FT                   /translation="MTTMTADPTDLPCPSRDRWQPLRAGLVDVFYYDAEEFRFYDGRLL
FT                   LRGNNGTGKSKVLALTLPFLLDGELTPSRVEPDGDRAKRMEWNLLLGGKHPNDERLGYT
FT                   WLEFGRLDENGVPQYRTVGCGLKAVKGRGIADHWFFVTDERVGPGLPLRNEHRVSYSRK
FT                   ALEEKIGAHAVFTTAKAYRRAVDEALFGLGAERYEALVNLLIQLRQPQLSKKPDEKLLS
FT                   KALTEALPPLADGLVGEIAEAFRGLQDERDALAALIEAHGAANAFLAHYRRYAQVAAKR
FT                   IAAGVRQSHSRYEQLGRDLGAATAAREQAHAAFTTAEGELTELDERQTLLTAQKDAYNR
FT                   DPAMGTAREIDRLAKAAETLAAVARTRAEDRHRAVRDADSWMHRSEQARQRAQSDAADV
FT                   DGRHREADAAGQAAGIDHGTLRSVIAAASAQADPPAPPIPSREASEDSIAAVEAAVAVA
FT                   RRSSDALIRDRQQAISGLRNLHQASETAARALAAARAAAERAAQRATASAEHAAASSGA
FT                   VAARGESLVAAWESWNSHCVETVLPDRDAAGSELELWVRTLDGPNPFARRAEEAGRVHA
FT                   AHLNRRVADVDGRRTRAEAERSALAAEIARLEQGGHNAPPAPRTRAADARSDRPGAPLW
FT                   KVVDYQDHVTAADRAGLEAALEASGLLDAWLAPDGRLLDDVTGDVVLAPTAAAPDVGLA
FT                   AVLRPAIDTADPQAAALEETAVAAVLAAIGGVPVGAAEPGHHTWISPDGRFRVGVLRGA
FT                   WRKESAHYIGERARETARRARLAELAGQTARLAAEIAALTGEARTVTARLDALAAELRE
FT                   QPSDAALREANTLAAAHADAAREAVAARDEALAAVEPAAEAAAEAVAATLTFAEDTRLP
FT                   AEAAALEAVAEALADYRHSLSGLWPAVTAAARAAAEAAMAEHERRVATARLAEADEAGL
FT                   AARHDAEAAAEEHRALVATSGAAVEELYRRLEAVRVELAAASAAATAVRARREQALKDR
FT                   ERAEGRRLQLESDIAEVAGLRDEAITVLRRFTATGLLAAALPDLEHPDPAEAWVPAPAV
FT                   TLARAIDAALAAVDEADGAWERVQARVVREQQELSGALARHGHQVGMTLQDGLMVVDVL
FT                   FAGRTQDIPALTSALDAEVAQRTRLLSAKERELLENHLVGEVAGALQELITEAEATVQA
FT                   MNDDLEARPTSTGMALRLVWRTAKGAPEGLEAIRTRLLRKAVDAWSPADRAAVGDFLAR
FT                   RITDDRAANPADTWHDQLTRAFDYRAWHEFGIQRRTDGAWTSASGPASGGERVLAASVP
FT                   LFAAASSHYSSGHPHAPRLIALDEAFAGVDDDSRAKCLGLLAAFDLDVVMTSEREWACY
FT                   PTVPGIGIAQLARAEGVDAVLVTPWRWDGRDRLRLTRPEPYLPPQRARDTPVPTDFEPS
FT                   LFDD"
     MTTMTADPTD LPCPSRDRWQ PLRAGLVDVF YYDAEEFRFY DGRLLLRGNN GTGKSKVLAL        60
     TLPFLLDGEL TPSRVEPDGD RAKRMEWNLL LGGKHPNDER LGYTWLEFGR LDENGVPQYR       120
     TVGCGLKAVK GRGIADHWFF VTDERVGPGL PLRNEHRVSY SRKALEEKIG AHAVFTTAKA       180
     YRRAVDEALF GLGAERYEAL VNLLIQLRQP QLSKKPDEKL LSKALTEALP PLADGLVGEI       240
     AEAFRGLQDE RDALAALIEA HGAANAFLAH YRRYAQVAAK RIAAGVRQSH SRYEQLGRDL       300
     GAATAAREQA HAAFTTAEGE LTELDERQTL LTAQKDAYNR DPAMGTAREI DRLAKAAETL       360
     AAVARTRAED RHRAVRDADS WMHRSEQARQ RAQSDAADVD GRHREADAAG QAAGIDHGTL       420
     RSVIAAASAQ ADPPAPPIPS REASEDSIAA VEAAVAVARR SSDALIRDRQ QAISGLRNLH       480
     QASETAARAL AAARAAAERA AQRATASAEH AAASSGAVAA RGESLVAAWE SWNSHCVETV       540
     LPDRDAAGSE LELWVRTLDG PNPFARRAEE AGRVHAAHLN RRVADVDGRR TRAEAERSAL       600
     AAEIARLEQG GHNAPPAPRT RAADARSDRP GAPLWKVVDY QDHVTAADRA GLEAALEASG       660
     LLDAWLAPDG RLLDDVTGDV VLAPTAAAPD VGLAAVLRPA IDTADPQAAA LEETAVAAVL       720
     AAIGGVPVGA AEPGHHTWIS PDGRFRVGVL RGAWRKESAH YIGERARETA RRARLAELAG       780
     QTARLAAEIA ALTGEARTVT ARLDALAAEL REQPSDAALR EANTLAAAHA DAAREAVAAR       840
     DEALAAVEPA AEAAAEAVAA TLTFAEDTRL PAEAAALEAV AEALADYRHS LSGLWPAVTA       900
     AARAAAEAAM AEHERRVATA RLAEADEAGL AARHDAEAAA EEHRALVATS GAAVEELYRR       960
     LEAVRVELAA ASAAATAVRA RREQALKDRE RAEGRRLQLE SDIAEVAGLR DEAITVLRRF      1020
     TATGLLAAAL PDLEHPDPAE AWVPAPAVTL ARAIDAALAA VDEADGAWER VQARVVREQQ      1080
     ELSGALARHG HQVGMTLQDG LMVVDVLFAG RTQDIPALTS ALDAEVAQRT RLLSAKEREL      1140
     LENHLVGEVA GALQELITEA EATVQAMNDD LEARPTSTGM ALRLVWRTAK GAPEGLEAIR      1200
     TRLLRKAVDA WSPADRAAVG DFLARRITDD RAANPADTWH DQLTRAFDYR AWHEFGIQRR      1260
     TDGAWTSASG PASGGERVLA ASVPLFAAAS SHYSSGHPHA PRLIALDEAF AGVDDDSRAK      1320
     CLGLLAAFDL DVVMTSEREW ACYPTVPGIG IAQLARAEGV DAVLVTPWRW DGRDRLRLTR      1380
     PEPYLPPQRA RDTPVPTDFE PSLFDD                                           1406
//

If you have problems or comments...

PBIL Back to PBIL home page