(data stored in ACNUC7421 zone)

EMBL: CP001700.PE485

CP001700.PE485       Location/Qualifiers
FT   CDS             complement(562099..563382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69440"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX89"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1083"
FT                   /protein_id="ACU69440.1"
FT                   /translation="MSAVDTAAGQPDPAAFGHTVSDETVTGQTSPHQPSDHHVERRRAA
FT                   RALLASPLLTARDDDFRLVRKHAAELAGWFADQAGWRLTVDAETARLFKKPAALDDATR
FT                   PAHAPKSKVPFTRRRYVLLCLALAVLERSESQTTLGRLAEGVLTGAADPALTEAGITFA
FT                   MERREERADLVAVVRLLLAWGVLTRVQGDEDAFVADSGNDVLYDLDRRVTGGLLATSRS
FT                   ASTVTATAFEQRLTTLAAEPIPDTDDLRLRSLRHAMTRRLLDDPVVYYADLTEPERAYL
FT                   AGQRVAITRRITDLTGLIPEMRAEGIAMVDPDDALTDVRMPEQGTDGHVTLLIATKLAT
FT                   DGMAPTVPELIRFVQAQARLHVSYWRKTAAEPAAAADLAEQAVAKLEALNLVIRVPDDH
FT                   GDVRIHPRSALMRFTMTDPTIKKAGARA"
     MSAVDTAAGQ PDPAAFGHTV SDETVTGQTS PHQPSDHHVE RRRAARALLA SPLLTARDDD        60
     FRLVRKHAAE LAGWFADQAG WRLTVDAETA RLFKKPAALD DATRPAHAPK SKVPFTRRRY       120
     VLLCLALAVL ERSESQTTLG RLAEGVLTGA ADPALTEAGI TFAMERREER ADLVAVVRLL       180
     LAWGVLTRVQ GDEDAFVADS GNDVLYDLDR RVTGGLLATS RSASTVTATA FEQRLTTLAA       240
     EPIPDTDDLR LRSLRHAMTR RLLDDPVVYY ADLTEPERAY LAGQRVAITR RITDLTGLIP       300
     EMRAEGIAMV DPDDALTDVR MPEQGTDGHV TLLIATKLAT DGMAPTVPEL IRFVQAQARL       360
     HVSYWRKTAA EPAAAADLAE QAVAKLEALN LVIRVPDDHG DVRIHPRSAL MRFTMTDPTI       420
     KKAGARA                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page