(data stored in ACNUC7421 zone)

EMBL: CP001700.PE486

CP001700.PE486       Location/Qualifiers
FT   CDS             complement(563379..565001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69441"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX90"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1084"
FT                   /protein_id="ACU69441.1"
FT                   /translation="MADVTDAPAPQPFAYLGTPNAPLYTGILDVFALAKQRFTVHLRPE
FT                   DVLADWPGARAGDRADAVRPAAEHLVQALDRLVEWGNLRSDADTGRVTTVEDFNRARRI
FT                   YQLTRHGQAALAAIEHYEQTLGQRGRLQTVALADIAEQLSALAVHAEAAEAPDQATVGL
FT                   LLFALTERFTGLADNAEAFMSSLRRTVDFSDGDGDEEAFLAYKDRLIEYIDKFIADLAN
FT                   RGAQIAGLIERIETAGIARILDAAACREAVDALPDVDRADVADAPDVYTAAVQAVTRDW
FT                   ENRWRGLREWFVSSGSRRPSQARLLRNAAVSGITNLVNTVAALNERRGGRSDRSADLRA
FT                   LARFFAQAPDDAAAHRLWRAAFALSPARHLTVDADTEDAWEQAEYPPGTPWAAAASLQI
FT                   SPRLRETGSYERRGAPNRAVDREAGRRQLAERAEREAAEIAEARRLLATDGPVLLSELA
FT                   GDAGLDPRAFRLFLSVLGDALAARRPGIATTTATSGDGTMEIRLKLVDAGQIVTIPTED
FT                   GVLSGPEHVVEIIDLTARPAAVR"
     MADVTDAPAP QPFAYLGTPN APLYTGILDV FALAKQRFTV HLRPEDVLAD WPGARAGDRA        60
     DAVRPAAEHL VQALDRLVEW GNLRSDADTG RVTTVEDFNR ARRIYQLTRH GQAALAAIEH       120
     YEQTLGQRGR LQTVALADIA EQLSALAVHA EAAEAPDQAT VGLLLFALTE RFTGLADNAE       180
     AFMSSLRRTV DFSDGDGDEE AFLAYKDRLI EYIDKFIADL ANRGAQIAGL IERIETAGIA       240
     RILDAAACRE AVDALPDVDR ADVADAPDVY TAAVQAVTRD WENRWRGLRE WFVSSGSRRP       300
     SQARLLRNAA VSGITNLVNT VAALNERRGG RSDRSADLRA LARFFAQAPD DAAAHRLWRA       360
     AFALSPARHL TVDADTEDAW EQAEYPPGTP WAAAASLQIS PRLRETGSYE RRGAPNRAVD       420
     REAGRRQLAE RAEREAAEIA EARRLLATDG PVLLSELAGD AGLDPRAFRL FLSVLGDALA       480
     ARRPGIATTT ATSGDGTMEI RLKLVDAGQI VTIPTEDGVL SGPEHVVEII DLTARPAAVR       540
//

If you have problems or comments...

PBIL Back to PBIL home page