(data stored in ACNUC7421 zone)

EMBL: CP001700.PE487

CP001700.PE487       Location/Qualifiers
FT   CDS             568223..569434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69442"
FT                   /db_xref="GOA:C7PX91"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69442.1"
FT                   /translation="MPHFFFSYSRKDAPDEYLYRFYDDLCREISVRSHFTIESAGFIDK
FT                   NQPVGGEWEDSIGVALGTCDVFVPVYSPSLFGSSNCGQEWHAFGTRQSRAGKLAPHIVP
FT                   VWWVPTPGELPTIADRIQDTRSQFGAEYQKYGLRYLMQLKENESLYRDFLVKFTMMVLA
FT                   AGENPPELMRDLSLAGAPNAFALKPETTGGRARPRSGLKAGGIKSVRFVVAAGSRDEMR
FT                   TIRAAVDAYGAGSLDWQPYHPEHPDPIVLHAQGVAIAHRMVSSFKAAMDDDLFELLERC
FT                   QASREPVVLIVDPWVVELDAYKDLLARLDTARFGTTAVVVPWESGATIESNLRDILTVH
FT                   LGNWMYAGERFFRDDIRSMGEFEANLGEVLVDMWSRIVKWSDAVRRVDESGPASRPILT
FT                   GPGS"
     MPHFFFSYSR KDAPDEYLYR FYDDLCREIS VRSHFTIESA GFIDKNQPVG GEWEDSIGVA        60
     LGTCDVFVPV YSPSLFGSSN CGQEWHAFGT RQSRAGKLAP HIVPVWWVPT PGELPTIADR       120
     IQDTRSQFGA EYQKYGLRYL MQLKENESLY RDFLVKFTMM VLAAGENPPE LMRDLSLAGA       180
     PNAFALKPET TGGRARPRSG LKAGGIKSVR FVVAAGSRDE MRTIRAAVDA YGAGSLDWQP       240
     YHPEHPDPIV LHAQGVAIAH RMVSSFKAAM DDDLFELLER CQASREPVVL IVDPWVVELD       300
     AYKDLLARLD TARFGTTAVV VPWESGATIE SNLRDILTVH LGNWMYAGER FFRDDIRSMG       360
     EFEANLGEVL VDMWSRIVKW SDAVRRVDES GPASRPILTG PGS                         403
//

If you have problems or comments...

PBIL Back to PBIL home page