(data stored in ACNUC7421 zone)

EMBL: CP001700.PE488

CP001700.PE488       Location/Qualifiers
FT   CDS             569440..572580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5724 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69443"
FT                   /db_xref="GOA:C7PX92"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69443.1"
FT                   /translation="MKGSIITFYSYKGGTGRSMALANAAWILASNGLRVLVVDWDLEAP
FT                   GLHRYFHPFLSDRDLRTSMGLIDLVWEFVAAALDSEAQDEPGWHEDFARISPYAMSIDF
FT                   DFPGRGTVDLVPAGKQDASYSALVSSFDWGNFYERLGGGGYLEALKRDMRLHYDYVLID
FT                   SRTGLSDTAGICTVHLPDILVNCFSLSTQAIDGAAAVAGSVHRQRENRQVRIFPVPMRV
FT                   EDGEQDKLDASRDFARERFGRFLFHVSDPERYWGEVEVPYKSFYAYEEILATFGDRPQQ
FT                   ENSVLAATERIVGYLSDGQVTALSSSLSESERRVWLTRFQRNGPKLSRTELDVRLPGPP
FT                   LKIFISYAHDSHEHFEEVRELWFLLRANGTDAQLGSPDNERRWNGPVPTATEIRTADLI
FT                   IVAVSPLYRRSTGDDGQTSGDESGAGVEARLIRDEVQGGYSVQRIIPVVLPSAAVTEVP
FT                   AYLADSPVRPVIVEQLTADGIRPLLRQVARFKRVDHKRADFNPSWRENLPKPEPDLEQA
FT                   ALQLARSVASGWEVSAAATLSRPPLATRWSGSQRRGSFDDLVNIFLTSSRGRLLVLGSA
FT                   GSGKTTTAVRLLLDLLARRTDEPIPILLAVATWRPDVEHINTWIIRRLQEDYTVGGIAE
FT                   RLVTTGMILPILDGLDELPVTQRALALDALSTLRINQPFVATCRTGDYRQVAAELGQML
FT                   ANTVVVELEPITSNDIRAYLAVDLPDSDRRWQPVFAHLREFPGGLLAQSMSNPFMLDLM
FT                   RDAYRRPNTDPAELLNNRLFPTTQAIEHRLFGTFIGRAYAPRPSTRPESTYDASSADRW
FT                   LSFLARSLHEQHTRDLSWWHLHRVLPPGGLRTLLALAAGFFGALMLGLAGLRFDVLPDI
FT                   AAIPGWVKGALAGTGLGLFVALVAREPVQLSKPSPRRAEPSPRRRQLGRLVGISADLNQ
FT                   ASSPAAALLIERRTVSTVGLLMVLVIGISELVSGIPRALVEPIVATAVGLIMVRFSTSS
FT                   WGWYSVTRWWLALRGVLPLRVMRFLGDAHARGVLRQQGVAYQFRDVALLEWFAGDHI"
     MKGSIITFYS YKGGTGRSMA LANAAWILAS NGLRVLVVDW DLEAPGLHRY FHPFLSDRDL        60
     RTSMGLIDLV WEFVAAALDS EAQDEPGWHE DFARISPYAM SIDFDFPGRG TVDLVPAGKQ       120
     DASYSALVSS FDWGNFYERL GGGGYLEALK RDMRLHYDYV LIDSRTGLSD TAGICTVHLP       180
     DILVNCFSLS TQAIDGAAAV AGSVHRQREN RQVRIFPVPM RVEDGEQDKL DASRDFARER       240
     FGRFLFHVSD PERYWGEVEV PYKSFYAYEE ILATFGDRPQ QENSVLAATE RIVGYLSDGQ       300
     VTALSSSLSE SERRVWLTRF QRNGPKLSRT ELDVRLPGPP LKIFISYAHD SHEHFEEVRE       360
     LWFLLRANGT DAQLGSPDNE RRWNGPVPTA TEIRTADLII VAVSPLYRRS TGDDGQTSGD       420
     ESGAGVEARL IRDEVQGGYS VQRIIPVVLP SAAVTEVPAY LADSPVRPVI VEQLTADGIR       480
     PLLRQVARFK RVDHKRADFN PSWRENLPKP EPDLEQAALQ LARSVASGWE VSAAATLSRP       540
     PLATRWSGSQ RRGSFDDLVN IFLTSSRGRL LVLGSAGSGK TTTAVRLLLD LLARRTDEPI       600
     PILLAVATWR PDVEHINTWI IRRLQEDYTV GGIAERLVTT GMILPILDGL DELPVTQRAL       660
     ALDALSTLRI NQPFVATCRT GDYRQVAAEL GQMLANTVVV ELEPITSNDI RAYLAVDLPD       720
     SDRRWQPVFA HLREFPGGLL AQSMSNPFML DLMRDAYRRP NTDPAELLNN RLFPTTQAIE       780
     HRLFGTFIGR AYAPRPSTRP ESTYDASSAD RWLSFLARSL HEQHTRDLSW WHLHRVLPPG       840
     GLRTLLALAA GFFGALMLGL AGLRFDVLPD IAAIPGWVKG ALAGTGLGLF VALVAREPVQ       900
     LSKPSPRRAE PSPRRRQLGR LVGISADLNQ ASSPAAALLI ERRTVSTVGL LMVLVIGISE       960
     LVSGIPRALV EPIVATAVGL IMVRFSTSSW GWYSVTRWWL ALRGVLPLRV MRFLGDAHAR      1020
     GVLRQQGVAY QFRDVALLEW FAGDHI                                           1046
//

If you have problems or comments...

PBIL Back to PBIL home page