(data stored in ACNUC7421 zone)

EMBL: CP001700.PE490

CP001700.PE490       Location/Qualifiers
FT   CDS             complement(573548..574078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69445"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69445.1"
FT                   /translation="MSTSPGMFGPVSAKGRTGQISFDGRAITITRGGILARGLSGSGTT
FT                   TVPIEQVTGVDFKPTGANHGRITILVAGTVAPRQNSTRSSTDPMTVDFTLHSNDFRRVR
FT                   DAIDTALRNRTAMTTSGWTMPPPPPPPGWAPPTMPAQEPSLADQIGNLARLKEHGHLSE
FT                   EEFAVAKAKLLGL"
     MSTSPGMFGP VSAKGRTGQI SFDGRAITIT RGGILARGLS GSGTTTVPIE QVTGVDFKPT        60
     GANHGRITIL VAGTVAPRQN STRSSTDPMT VDFTLHSNDF RRVRDAIDTA LRNRTAMTTS       120
     GWTMPPPPPP PGWAPPTMPA QEPSLADQIG NLARLKEHGH LSEEEFAVAK AKLLGL           176
//

If you have problems or comments...

PBIL Back to PBIL home page