(data stored in ACNUC7421 zone)

EMBL: CP001700.PE491

CP001700.PE491       Location/Qualifiers
FT   CDS             574640..575116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0496"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   sma:SAV_2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69446"
FT                   /db_xref="GOA:C7PX95"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX95"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ACU69446.1"
FT                   /translation="MTVESGIREAGRLCVEPGLSDAMRAVAAFHTAFDLPRQPVPSTDV
FT                   STELAQLRVDLLVEEVGEFADATSKRDLTAMADALGDIIYVAYGAAVTYGIDLDAVLME
FT                   IHRSNMSKLGSDGRPVLRQDGKVLKSSSYRPPDVARVLAEQSELTVVSEAIDHP"
     MTVESGIREA GRLCVEPGLS DAMRAVAAFH TAFDLPRQPV PSTDVSTELA QLRVDLLVEE        60
     VGEFADATSK RDLTAMADAL GDIIYVAYGA AVTYGIDLDA VLMEIHRSNM SKLGSDGRPV       120
     LRQDGKVLKS SSYRPPDVAR VLAEQSELTV VSEAIDHP                               158
//

If you have problems or comments...

PBIL Back to PBIL home page