(data stored in ACNUC7421 zone)

EMBL: CP001700.PE492

CP001700.PE492       Location/Qualifiers
FT   CDS             575177..576604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0497"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sus:Acid_6274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69447"
FT                   /db_xref="GOA:C7PX96"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR031053"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX96"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACU69447.1"
FT                   /translation="MAAEGAITESSSWTNTSVLLFVGDDDPLAAVTALAKKIINEAEDC
FT                   GLQGPPFDPFALAELLGLSLRARADIADAHISADTIGVRSTPDAPLGHFVQAKRSLAIE
FT                   YNPTRPRGRLRYSVAHEIAHALFPDVADVVRHRTGSGGVAGYGGDDSWQLELLCNVVAA
FT                   ELLMPDQAVAGLIDIDPDIDFIMEYRRRFDVSTEALLRRLVGLTGRGLALVAASRSQDD
FT                   ASASLIVEYVVGSAQFSPRVHRGATVSSAGAFGKCVAVSQTARGVETLETVPLRVQAVG
FT                   VPPYPGFSLPRVLALVEPVVPIGKESGGLRYRSGDVTNFSAGDRPVVIAHVVNDSAHAW
FT                   SRRGVAAALSTRFPAAARAFQAWTVAAPTNLELGRVHAVDVTTGQSLVTIASMVVQRGY
FT                   GAGFSTRLDYQALDTALAAVAKFALTKGADVHLPRIGAGQAGGRWDLIAQAIERNLVGA
FT                   GLEVVVYTLPQRPRGKT"
     MAAEGAITES SSWTNTSVLL FVGDDDPLAA VTALAKKIIN EAEDCGLQGP PFDPFALAEL        60
     LGLSLRARAD IADAHISADT IGVRSTPDAP LGHFVQAKRS LAIEYNPTRP RGRLRYSVAH       120
     EIAHALFPDV ADVVRHRTGS GGVAGYGGDD SWQLELLCNV VAAELLMPDQ AVAGLIDIDP       180
     DIDFIMEYRR RFDVSTEALL RRLVGLTGRG LALVAASRSQ DDASASLIVE YVVGSAQFSP       240
     RVHRGATVSS AGAFGKCVAV SQTARGVETL ETVPLRVQAV GVPPYPGFSL PRVLALVEPV       300
     VPIGKESGGL RYRSGDVTNF SAGDRPVVIA HVVNDSAHAW SRRGVAAALS TRFPAAARAF       360
     QAWTVAAPTN LELGRVHAVD VTTGQSLVTI ASMVVQRGYG AGFSTRLDYQ ALDTALAAVA       420
     KFALTKGADV HLPRIGAGQA GGRWDLIAQA IERNLVGAGL EVVVYTLPQR PRGKT            475
//

If you have problems or comments...

PBIL Back to PBIL home page