(data stored in ACNUC7421 zone)

EMBL: CP001700.PE493

CP001700.PE493       Location/Qualifiers
FT   CDS             576658..578310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0498"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sus:Acid_6275 adenylosuccinate synthetase;
FT                   PFAM: adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69448"
FT                   /db_xref="GOA:C7PX97"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX97"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ACU69448.1"
FT                   /translation="MKTRPRLVVISGPVGSGKSTLARRLVSRYGAFDIRTQDLMRAHAV
FT                   AYDKELPLERRALQEYGEQLDIDTGGGWVAEGVAKLLDQRDEPIDGHGLIVVDSVRAHH
FT                   QVERLREAYGARVTHIHLNAPESVLGERYAERGDASGLVELDSYTEVAQNKTESAVGQL
FT                   ESEADITIDTQRNLPGDVETRAAAALGLYASRTDKLVDVLIGAQYGSEGKGNIAFYLAP
FT                   EYDVLVRVGGPNAGHKVPLPTPYTHRLLPSGSRANLAACIVIGPGATLSLEVLMREIAE
FT                   SGVEVDRLSIDPQCMIIENADLDAEAQLVGKIGSTGKGGGAAAARRIMGRHYDEASETP
FT                   VRLARDVQELVPYVRPTGEILDDAFARGHRVLLEGTQGTGLSLYHGSYPHVTSRDTTTA
FT                   GTLAEAGIGIHRVRRVIIVARTYPIRVKNPDEGTSGPMSQELSWEEIARRSGIPEEELV
FT                   KQEKGSVSNNQRRVAEFDWQMLRRASEINGATDVALTFTDYLDIGNRDARRYEQLSPKT
FT                   IDFIEEVERVAGVPVSLLGTRFDIRSVIDRRQW"
     MKTRPRLVVI SGPVGSGKST LARRLVSRYG AFDIRTQDLM RAHAVAYDKE LPLERRALQE        60
     YGEQLDIDTG GGWVAEGVAK LLDQRDEPID GHGLIVVDSV RAHHQVERLR EAYGARVTHI       120
     HLNAPESVLG ERYAERGDAS GLVELDSYTE VAQNKTESAV GQLESEADIT IDTQRNLPGD       180
     VETRAAAALG LYASRTDKLV DVLIGAQYGS EGKGNIAFYL APEYDVLVRV GGPNAGHKVP       240
     LPTPYTHRLL PSGSRANLAA CIVIGPGATL SLEVLMREIA ESGVEVDRLS IDPQCMIIEN       300
     ADLDAEAQLV GKIGSTGKGG GAAAARRIMG RHYDEASETP VRLARDVQEL VPYVRPTGEI       360
     LDDAFARGHR VLLEGTQGTG LSLYHGSYPH VTSRDTTTAG TLAEAGIGIH RVRRVIIVAR       420
     TYPIRVKNPD EGTSGPMSQE LSWEEIARRS GIPEEELVKQ EKGSVSNNQR RVAEFDWQML       480
     RRASEINGAT DVALTFTDYL DIGNRDARRY EQLSPKTIDF IEEVERVAGV PVSLLGTRFD       540
     IRSVIDRRQW                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page