(data stored in ACNUC7421 zone)

EMBL: CP001700.PE494

CP001700.PE494       Location/Qualifiers
FT   CDS             578304..579032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69449"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX98"
FT                   /inference="similar to AA sequence:KEGG:Acid_6276"
FT                   /protein_id="ACU69449.1"
FT                   /translation="MVSTAWAFTTMTSERRLSNVQRDELINKYPVLYHMAEEGTWPSIQ
FT                   KRGLLSTQALVDLYNPEPAVKNSILGAVRRSSIALDNPVLGRTIIRDQRPLKFLDKCLL
FT                   PGTSPQQFLDVLNGRVFFWLARHRLETLLSARLYRDKQQTVLHVDTGRLMERYGDEVEL
FT                   APYNTGSMHIPNAPRRGKDVFVAVDDYPYDDWRVQRGSKGDAVVELTVPYAVPDISDMT
FT                   LRVESWSGGDVVDVIYSAPD"
     MVSTAWAFTT MTSERRLSNV QRDELINKYP VLYHMAEEGT WPSIQKRGLL STQALVDLYN        60
     PEPAVKNSIL GAVRRSSIAL DNPVLGRTII RDQRPLKFLD KCLLPGTSPQ QFLDVLNGRV       120
     FFWLARHRLE TLLSARLYRD KQQTVLHVDT GRLMERYGDE VELAPYNTGS MHIPNAPRRG       180
     KDVFVAVDDY PYDDWRVQRG SKGDAVVELT VPYAVPDISD MTLRVESWSG GDVVDVIYSA       240
     PD                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page