(data stored in ACNUC7421 zone)

EMBL: CP001700.PE495

CP001700.PE495       Location/Qualifiers
FT   CDS             complement(579523..580476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69450"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX99"
FT                   /inference="similar to AA sequence:KEGG:SGR_3293"
FT                   /protein_id="ACU69450.1"
FT                   /translation="MKMVAWLAQHARPGVSWDRLALQAFDEDMPVPSEGIRRAFTRQID
FT                   KTRLPGGIALDSAPGTDRETWAVEAAETVTATGATMFRPLARIARIDSAVQSLLAAHAP
FT                   WPPQEYADLDRRTDTDRTPAEITQMAVAAIIDPENYLPGSTIADVLAALLPEGQLSPMA
FT                   SFLEFSDLDATELTAAEWLGKNMAGSILEELRAAIAAADIAELRQAYRAAQACTRRTGE
FT                   LLNSVEAEIGAGTLGDACRAWVSAAAFGLPRIMLLVTARDRKPHEFAISAALLLWTNRM
FT                   VSRLRSAFPGGFTALDEPLRQMVEGLSLAVLTGEDA"
     MKMVAWLAQH ARPGVSWDRL ALQAFDEDMP VPSEGIRRAF TRQIDKTRLP GGIALDSAPG        60
     TDRETWAVEA AETVTATGAT MFRPLARIAR IDSAVQSLLA AHAPWPPQEY ADLDRRTDTD       120
     RTPAEITQMA VAAIIDPENY LPGSTIADVL AALLPEGQLS PMASFLEFSD LDATELTAAE       180
     WLGKNMAGSI LEELRAAIAA ADIAELRQAY RAAQACTRRT GELLNSVEAE IGAGTLGDAC       240
     RAWVSAAAFG LPRIMLLVTA RDRKPHEFAI SAALLLWTNR MVSRLRSAFP GGFTALDEPL       300
     RQMVEGLSLA VLTGEDA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page