(data stored in ACNUC7421 zone)

EMBL: CP001700.PE497

CP001700.PE497       Location/Qualifiers
FT   CDS             complement(582089..586327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0505"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; PKD domain containing protein; SMART:
FT                   PKD domain containing protein; Parallel beta- helix repeat;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69452"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA1"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69452.1"
FT                   /translation="MRARRVTLAALSALGVSVGVASAPAHAAAPTTIYVDNGSAACSDT
FT                   GSGTQDQPFCTINAAAKSAAPDDTVLIEPGTGHYSEPMMNIQTSGTPGHPITYQAAQGT
FT                   FTMGNVNSPGQYDAAYGLRFDQTVHDIVIQGFHFGGGLWVDEESARFQVRNNFFDGSGL
FT                   AMYDGEAMEVTGNTFTNAPLSVEGAMGGISEPTPTLVDHNTVVGGSIWADMGSTTVTHN
FT                   TVSGSSTFGILAGTNKSSSMWDAQVTIAGNLVYGNAGGGISAANWGATITGNTIADNGG
FT                   NQVEIHSPTPIPYTPPSPPQTHVENNIIATGTTLPHSAAATASQIGITVDQAAWATTFV
FT                   DRNVVSLAQGRPYEIGTTIVPDGAHLAALGHGGTAEINAAPLLNADGTLRAGSPAVDSA
FT                   DSAAAGEQATDLAGNTRHDDSGVCDTGAGSRSYDDRGAFEFQGTTSPAVACAAPTAPVP
FT                   AAPAPTVDSVDFPATGGYFGVGRAGYFHVADHSGARNPIQFSVDGGVAQQLLADASGSL
FT                   MIPYTATTAGPHWIDVQVVGASPSLTTRYTFTVPATDTVVAPTAYFTVAGDRANPKSVT
FT                   VNAIKSLHGTTPIQSFTYHFGDGTSTGPTSATSATHIYSTADKFPITVTVQDTDSLSNS
FT                   MQATYDASTGQTSTPKPSPNTIHVNNAAGANCSDAAGSGSASKPFCTIAAAAALTNPGD
FT                   TVLVSAGTYASGVDITRSGTPGDPITYTTSGTVDLVSPSNAAYMGTAFTLSGVHDVTVH
FT                   GFVMDTKGSNGVLVGNSQNVEISGNTINDDGVFGASTYEGVQFTNVTDSAIVDNTVNAG
FT                   DIQGIVVDSGSLRAAIQGNTVRATRNVVYYTMIQDAAPNSTVVGNRVSNPESRDIAISS
FT                   GADGTVVAGNMATCSNVGISVDANNVAVTANTVMQTAGRELAVGGNGNVTGTSIRDNVF
FT                   AIPDNTFDCGSPNDGSIGMYGVDIYAGSTAGTTLDHNDVWFPLYGPGYQWGDTEYAVTT
FT                   PAQLAAFTTATGQSAHDTVAWPMLDANGAPRPGSPTIDAADSSATGYPDKDLLGNPRVD
FT                   DSTTPNTGLGPIAYGDMGAVEYQPQAPGGGTPTPTPTPTPPPTPTPAPVPNPGTGQPTV
FT                   QRLGGGTRYATGLMVSQHQWAAGKASAVVLARGDAAPDALAGVPFAAHVHGPLLLTDPS
FT                   ALDSETRSEIDRVLGGPHSGKTVYILGGAGAVAPSIEKGLRDAGYKVVRYGGDSRFSTA
FT                   LQIASAFGPTDHVIVATGRNFPDALSAGSLGAAEGAPIVLSDDTVLDAATAAFVARHPA
FT                   IDPVGVQAQHAVAGLAAGRTVDRSLAGSDRYVTATDVATRVAQILGHTPATVGVASGTA
FT                   FPDALTGGAFIANAGGALVLTDPTRLTASTGALLTGWHGGLSTIEVFGGPLAVSGPTYD
FT                   AIVKTVGARS"
     MRARRVTLAA LSALGVSVGV ASAPAHAAAP TTIYVDNGSA ACSDTGSGTQ DQPFCTINAA        60
     AKSAAPDDTV LIEPGTGHYS EPMMNIQTSG TPGHPITYQA AQGTFTMGNV NSPGQYDAAY       120
     GLRFDQTVHD IVIQGFHFGG GLWVDEESAR FQVRNNFFDG SGLAMYDGEA MEVTGNTFTN       180
     APLSVEGAMG GISEPTPTLV DHNTVVGGSI WADMGSTTVT HNTVSGSSTF GILAGTNKSS       240
     SMWDAQVTIA GNLVYGNAGG GISAANWGAT ITGNTIADNG GNQVEIHSPT PIPYTPPSPP       300
     QTHVENNIIA TGTTLPHSAA ATASQIGITV DQAAWATTFV DRNVVSLAQG RPYEIGTTIV       360
     PDGAHLAALG HGGTAEINAA PLLNADGTLR AGSPAVDSAD SAAAGEQATD LAGNTRHDDS       420
     GVCDTGAGSR SYDDRGAFEF QGTTSPAVAC AAPTAPVPAA PAPTVDSVDF PATGGYFGVG       480
     RAGYFHVADH SGARNPIQFS VDGGVAQQLL ADASGSLMIP YTATTAGPHW IDVQVVGASP       540
     SLTTRYTFTV PATDTVVAPT AYFTVAGDRA NPKSVTVNAI KSLHGTTPIQ SFTYHFGDGT       600
     STGPTSATSA THIYSTADKF PITVTVQDTD SLSNSMQATY DASTGQTSTP KPSPNTIHVN       660
     NAAGANCSDA AGSGSASKPF CTIAAAAALT NPGDTVLVSA GTYASGVDIT RSGTPGDPIT       720
     YTTSGTVDLV SPSNAAYMGT AFTLSGVHDV TVHGFVMDTK GSNGVLVGNS QNVEISGNTI       780
     NDDGVFGAST YEGVQFTNVT DSAIVDNTVN AGDIQGIVVD SGSLRAAIQG NTVRATRNVV       840
     YYTMIQDAAP NSTVVGNRVS NPESRDIAIS SGADGTVVAG NMATCSNVGI SVDANNVAVT       900
     ANTVMQTAGR ELAVGGNGNV TGTSIRDNVF AIPDNTFDCG SPNDGSIGMY GVDIYAGSTA       960
     GTTLDHNDVW FPLYGPGYQW GDTEYAVTTP AQLAAFTTAT GQSAHDTVAW PMLDANGAPR      1020
     PGSPTIDAAD SSATGYPDKD LLGNPRVDDS TTPNTGLGPI AYGDMGAVEY QPQAPGGGTP      1080
     TPTPTPTPPP TPTPAPVPNP GTGQPTVQRL GGGTRYATGL MVSQHQWAAG KASAVVLARG      1140
     DAAPDALAGV PFAAHVHGPL LLTDPSALDS ETRSEIDRVL GGPHSGKTVY ILGGAGAVAP      1200
     SIEKGLRDAG YKVVRYGGDS RFSTALQIAS AFGPTDHVIV ATGRNFPDAL SAGSLGAAEG      1260
     APIVLSDDTV LDAATAAFVA RHPAIDPVGV QAQHAVAGLA AGRTVDRSLA GSDRYVTATD      1320
     VATRVAQILG HTPATVGVAS GTAFPDALTG GAFIANAGGA LVLTDPTRLT ASTGALLTGW      1380
     HGGLSTIEVF GGPLAVSGPT YDAIVKTVGA RS                                    1412
//

If you have problems or comments...

PBIL Back to PBIL home page