(data stored in ACNUC7421 zone)

EMBL: CP001700.PE498

CP001700.PE498       Location/Qualifiers
FT   CDS             586579..587925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0506"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; SMART: PKD domain containing protein;
FT                   KEGG: ace:Acel_1461 cell wall binding repeat 2- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69453"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA2"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69453.1"
FT                   /translation="MSRSIGFGLALVAVLGTGLGPIAPVHADPAASPAKLSHVSPLFQP
FT                   SLTVTAQNDHGLIAVTMPAAGGQYSLSMGDGTTLRGADNQPEIYYTYQASGRYLVQLAD
FT                   TDAGGSTGTAAVWVDVTVATAPPLAHAVARISGGDRYATAIAVSRTAWTGGSAKAVVLA
FT                   RGDKYPDALSGVPLAAHVGGPLLLTDPTVLDTATRAEIDRVLGGPASGRTVYILGGTAA
FT                   ISPGVEKGLVSAGYHVVRYSGADRAGTALAVAQQAFTSAPGALIATDTDFADALAAGPL
FT                   AAALGEPILLTGQWTISDGAWNWLQQHPRVGTVGEPALAVISERAMHGWGNIRANDGFQ
FT                   GPDRYTTALAVAHAMIDQTSGSLPPGRSTGVCFASGETFPDALSGGALCALQNRPMLLL
FT                   PATGGEGDVLAALDHWNGALSQAELFGGPAALSQTAEDQVAQALSFTEN"
     MSRSIGFGLA LVAVLGTGLG PIAPVHADPA ASPAKLSHVS PLFQPSLTVT AQNDHGLIAV        60
     TMPAAGGQYS LSMGDGTTLR GADNQPEIYY TYQASGRYLV QLADTDAGGS TGTAAVWVDV       120
     TVATAPPLAH AVARISGGDR YATAIAVSRT AWTGGSAKAV VLARGDKYPD ALSGVPLAAH       180
     VGGPLLLTDP TVLDTATRAE IDRVLGGPAS GRTVYILGGT AAISPGVEKG LVSAGYHVVR       240
     YSGADRAGTA LAVAQQAFTS APGALIATDT DFADALAAGP LAAALGEPIL LTGQWTISDG       300
     AWNWLQQHPR VGTVGEPALA VISERAMHGW GNIRANDGFQ GPDRYTTALA VAHAMIDQTS       360
     GSLPPGRSTG VCFASGETFP DALSGGALCA LQNRPMLLLP ATGGEGDVLA ALDHWNGALS       420
     QAELFGGPAA LSQTAEDQVA QALSFTEN                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page