(data stored in ACNUC7421 zone)

EMBL: CP001700.PE499

CP001700.PE499       Location/Qualifiers
FT   CDS             587952..589754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0507"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69454"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA3"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69454.1"
FT                   /translation="MTRIRLAAPLILSSAALISALMPPLTASAAGTASTPCAPAPVTGT
FT                   PTGPLTAAVQSDDFPSLSGGLPPTHGPNQPGVFHLSGSGGVSPIVCFQYSVPETGVSNA
FT                   TISADASGRANLTLALPYAGLASVTVSAVDAAGNVSAPVTYSFNVLSAVPTKLSAQIEI
FT                   GGSSDGTVTGVVTASGPNPVLNYHVDFGDGTTVNQASPAFRHVYRSTWWYQIVVTVTDS
FT                   SGATTTATALNVRTTVPSTMQRVSGTTRYDTSTAVSRRLWADAADDQTDRLAAHTVVLA
FT                   SGATFPDALAGIPLASYKQGPLLLTEPQQLTDTTRQEIHRVLPKGGTVYVLGGQNAVSP
FT                   DVAATLSGDGYHVIRYGGKTRYETALIIAKQGLDNPAHVVIATGTDYPDALAAGPAATG
FT                   RLSSGGKPAAILLSDGATFNDAATAAYIRSKLVRYQTGMPNVTAIGWSSTLAGLAMIGV
FT                   PDYIIDSTIKPGTPAKSGGDSWGTDIGTLYFIAGADRYTTAEGVAIEDTGPDCCAPDDP
FT                   FVGYASGNGFADALTGGAALATLHGRLFLTAPNYVPTATTAIFPGPPDQVKGTTYTGTV
FT                   FGGTQAVSQGVEDRLAQVLEAKEQ"
     MTRIRLAAPL ILSSAALISA LMPPLTASAA GTASTPCAPA PVTGTPTGPL TAAVQSDDFP        60
     SLSGGLPPTH GPNQPGVFHL SGSGGVSPIV CFQYSVPETG VSNATISADA SGRANLTLAL       120
     PYAGLASVTV SAVDAAGNVS APVTYSFNVL SAVPTKLSAQ IEIGGSSDGT VTGVVTASGP       180
     NPVLNYHVDF GDGTTVNQAS PAFRHVYRST WWYQIVVTVT DSSGATTTAT ALNVRTTVPS       240
     TMQRVSGTTR YDTSTAVSRR LWADAADDQT DRLAAHTVVL ASGATFPDAL AGIPLASYKQ       300
     GPLLLTEPQQ LTDTTRQEIH RVLPKGGTVY VLGGQNAVSP DVAATLSGDG YHVIRYGGKT       360
     RYETALIIAK QGLDNPAHVV IATGTDYPDA LAAGPAATGR LSSGGKPAAI LLSDGATFND       420
     AATAAYIRSK LVRYQTGMPN VTAIGWSSTL AGLAMIGVPD YIIDSTIKPG TPAKSGGDSW       480
     GTDIGTLYFI AGADRYTTAE GVAIEDTGPD CCAPDDPFVG YASGNGFADA LTGGAALATL       540
     HGRLFLTAPN YVPTATTAIF PGPPDQVKGT TYTGTVFGGT QAVSQGVEDR LAQVLEAKEQ       600
//

If you have problems or comments...

PBIL Back to PBIL home page