(data stored in ACNUC7421 zone)

EMBL: CP001700.PE5

CP001700.PE5         Location/Qualifiers
FT   CDS             6140..6658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sgr:SGR_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68960"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM1"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU68960.1"
FT                   /translation="MNPQPVDNGSGAEGGDPQDSGVDLARAALAAARARGKDNGAGWSG
FT                   NRRRNSNSGQRSGSGPDERDPQLLSSAIPRMIEARGWSVPAAVGGVMGRWGEIVGSHIS
FT                   AHCTPVEFHDGVLMVRTDSAAWATELRMLAPQLLAKLNAELGTSRAAHGGRDAAGAIAT
FT                   LKVVGPGGR"
     MNPQPVDNGS GAEGGDPQDS GVDLARAALA AARARGKDNG AGWSGNRRRN SNSGQRSGSG        60
     PDERDPQLLS SAIPRMIEAR GWSVPAAVGG VMGRWGEIVG SHISAHCTPV EFHDGVLMVR       120
     TDSAAWATEL RMLAPQLLAK LNAELGTSRA AHGGRDAAGA IATLKVVGPG GR               172
//

If you have problems or comments...

PBIL Back to PBIL home page