(data stored in ACNUC7421 zone)

EMBL: CP001700.PE50

CP001700.PE50        Location/Qualifiers
FT   CDS             complement(49782..50486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0050"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sgr:SGR_3318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69005"
FT                   /db_xref="GOA:C7QFR6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR6"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU69005.1"
FT                   /translation="MSVLGVAFTGVVAGVSAGLSVLCWPPRQQGHPARRLAFLATRNTT
FT                   ADHTRSRPWSAFLKRLRNNPWSTARHQRQHSEATARISPVAADLLAACLASGADPLRAA
FT                   EVVAYCLRPPGRLGTLGERAAAEMADRFQEVAHLLRLGGNPITTWRVVAAEPGLRPVAE
FT                   AIGRAGLSGAPPVASIRACATDLRKERHAASTAAARRAGVRGVAPLAGCFLPAFVLIGV
FT                   TPIVLGLAHHLL"
     MSVLGVAFTG VVAGVSAGLS VLCWPPRQQG HPARRLAFLA TRNTTADHTR SRPWSAFLKR        60
     LRNNPWSTAR HQRQHSEATA RISPVAADLL AACLASGADP LRAAEVVAYC LRPPGRLGTL       120
     GERAAAEMAD RFQEVAHLLR LGGNPITTWR VVAAEPGLRP VAEAIGRAGL SGAPPVASIR       180
     ACATDLRKER HAASTAAARR AGVRGVAPLA GCFLPAFVLI GVTPIVLGLA HHLL             234
//

If you have problems or comments...

PBIL Back to PBIL home page