(data stored in ACNUC7421 zone)

EMBL: CP001700.PE500

CP001700.PE500       Location/Qualifiers
FT   CDS             591312..593135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0509"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: fal:FRAAL6687
FT                   putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69455"
FT                   /db_xref="GOA:C7PXA4"
FT                   /db_xref="InterPro:IPR003032"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69455.1"
FT                   /translation="MADRLRYQLPARPTTTLRWVFFVLAVVSLVFGYVGLHAYILQQKP
FT                   HPQYSHAPGDLIYFDIELFLVQSTPIAAGGPYPFLLAVARFSAPLVSAYTIVEIALGLS
FT                   AHRIHGVRMRRYRGHAVVCGSSRTATVLAERLRRDRRRVVTIEPGTDDRRRADVVIGDP
FT                   ALPARLREAGVERAAVVYSCLDDSHRNVEVAGTIERIRAHTDRPGRADRPGHVGRPGRR
FT                   GPVRVHAMVKDLDLCLALKARHWSTAGGDGPYVDFYNPDELAAQDVVRSDDRLFTHDPP
FT                   RVAIAGTGAFGRAVLVELGRQWLVRRKQSSASLQVKVIGEQALKEVAAVAARYSFLDEV
FT                   CMVQTRTGTPAEFLTELTRLDTPRLHRLYLCQEDEGQALGTALAAVAHLSSALEVIVVR
FT                   LDRMSGMARAFDHGTGAGALFDGLDGRLRIVDVAQVGGDPAVIGFDLAEALARTSHQRY
FT                   LLERLASGKPLGSAPAMTPWETLDEDLRAASRALAGDVGRKAAALGGLLVPRSASGQDF
FT                   AFQPGEIEALARREHDRWQAERTGRGWRYGPRRDPVAKRHPDLNSWAQLPESERERDRE
FT                   VVRAMPSVLAEVGLAIVRVGPSEFTAEELAA"
     MADRLRYQLP ARPTTTLRWV FFVLAVVSLV FGYVGLHAYI LQQKPHPQYS HAPGDLIYFD        60
     IELFLVQSTP IAAGGPYPFL LAVARFSAPL VSAYTIVEIA LGLSAHRIHG VRMRRYRGHA       120
     VVCGSSRTAT VLAERLRRDR RRVVTIEPGT DDRRRADVVI GDPALPARLR EAGVERAAVV       180
     YSCLDDSHRN VEVAGTIERI RAHTDRPGRA DRPGHVGRPG RRGPVRVHAM VKDLDLCLAL       240
     KARHWSTAGG DGPYVDFYNP DELAAQDVVR SDDRLFTHDP PRVAIAGTGA FGRAVLVELG       300
     RQWLVRRKQS SASLQVKVIG EQALKEVAAV AARYSFLDEV CMVQTRTGTP AEFLTELTRL       360
     DTPRLHRLYL CQEDEGQALG TALAAVAHLS SALEVIVVRL DRMSGMARAF DHGTGAGALF       420
     DGLDGRLRIV DVAQVGGDPA VIGFDLAEAL ARTSHQRYLL ERLASGKPLG SAPAMTPWET       480
     LDEDLRAASR ALAGDVGRKA AALGGLLVPR SASGQDFAFQ PGEIEALARR EHDRWQAERT       540
     GRGWRYGPRR DPVAKRHPDL NSWAQLPESE RERDREVVRA MPSVLAEVGL AIVRVGPSEF       600
     TAEELAA                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page