(data stored in ACNUC7421 zone)

EMBL: CP001700.PE501

CP001700.PE501       Location/Qualifiers
FT   CDS             complement(593159..593641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69456"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA5"
FT                   /inference="similar to AA sequence:KEGG:nfa54480"
FT                   /protein_id="ACU69456.1"
FT                   /translation="MRLGITGHLDLTVSTERAVVAALRRHLLACGVPGELIGVSCMARG
FT                   ADSLFAQALIELGGRLEVIIPSVDYRQSQVTPDHEPVFSAMLDRAAAVHQMPAARAAAE
FT                   AYAEANRLLLASIDELVAVWDGGLDGPVGGTMDVVLTALACGIPVTVIWPEGAERG"
     MRLGITGHLD LTVSTERAVV AALRRHLLAC GVPGELIGVS CMARGADSLF AQALIELGGR        60
     LEVIIPSVDY RQSQVTPDHE PVFSAMLDRA AAVHQMPAAR AAAEAYAEAN RLLLASIDEL       120
     VAVWDGGLDG PVGGTMDVVL TALACGIPVT VIWPEGAERG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page