(data stored in ACNUC7421 zone)

EMBL: CP001700.PE503

CP001700.PE503       Location/Qualifiers
FT   CDS             594069..596516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0512"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_2654 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69458"
FT                   /db_xref="GOA:C7PXA7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="InterPro:IPR026337"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69458.1"
FT                   /translation="MSEQIVFPFRQFILKVHSRCDLACNHCYMYEGADQSWQARPKVMS
FT                   LETAERIGGRIADHARRHGVDSVRLILHGGEPLLAGTEQLEGIILRLRKVLDGITADIR
FT                   VHTNAVRLDARFLDLFVKHDVRVGVSLDGDRLANDRHRLYSDGRTSHPQVRAALALLRR
FT                   PEYEHLYSGILCTVDIANDAIAVYEALLAEKPPRIGLLLPHATWDIPPPRPLDPGTGAP
FT                   SATAYADWLITIFDRWRADGRPMGIRIFDSVSSTLHGGPPLSEALGLAPSDLVVIETDG
FT                   EIEQLDSLKVAFDGAPKTGLTVADDDLDLALAHPGMRARQSGLAGLSEQCRSCEVVESC
FT                   GGGLFPHRYQSDSGFDNPSVYCEDLKKLILHIAQSDRRRADHGRDSVTRHRIADAQLAE
FT                   LASGFGDAAAVTALMDVQASIARGLLATVAEQLAMRESPARTAWNALIELDRAQPTALA
FT                   AVLAQPYFRTWAHRVLSAGVRDHDAHRLSALTLAVAVHAGSELELTLHAEQGAIHLPWL
FT                   GTLRVPGPSSYVRVATTAPNRLLIGTGPDRFAVTLDDETPAGLWEPIRTLHSEGFAILL
FT                   DDGDPERDCYGWPATSRLSAADHDRWQQSFDAAWRLILADHPGYAPGLAAGLSTVTPLR
FT                   PAPAGRAKSATARQAPGAVGAALPDAPELLALLLLHEFQHVKLGAVLDAYDLYDESDRR
FT                   RYYAPWRDDARPIEGLLQGTYAHLAVTDFWRVQRLRAVGEAAETAEVNFARWRLHTAEA
FT                   IEVLAASGSLTELGQQFTDSMRATVAPWLDEPVSSQAGQAARSSAERHLAAYLRRAGHA
FT                   SDV"
     MSEQIVFPFR QFILKVHSRC DLACNHCYMY EGADQSWQAR PKVMSLETAE RIGGRIADHA        60
     RRHGVDSVRL ILHGGEPLLA GTEQLEGIIL RLRKVLDGIT ADIRVHTNAV RLDARFLDLF       120
     VKHDVRVGVS LDGDRLANDR HRLYSDGRTS HPQVRAALAL LRRPEYEHLY SGILCTVDIA       180
     NDAIAVYEAL LAEKPPRIGL LLPHATWDIP PPRPLDPGTG APSATAYADW LITIFDRWRA       240
     DGRPMGIRIF DSVSSTLHGG PPLSEALGLA PSDLVVIETD GEIEQLDSLK VAFDGAPKTG       300
     LTVADDDLDL ALAHPGMRAR QSGLAGLSEQ CRSCEVVESC GGGLFPHRYQ SDSGFDNPSV       360
     YCEDLKKLIL HIAQSDRRRA DHGRDSVTRH RIADAQLAEL ASGFGDAAAV TALMDVQASI       420
     ARGLLATVAE QLAMRESPAR TAWNALIELD RAQPTALAAV LAQPYFRTWA HRVLSAGVRD       480
     HDAHRLSALT LAVAVHAGSE LELTLHAEQG AIHLPWLGTL RVPGPSSYVR VATTAPNRLL       540
     IGTGPDRFAV TLDDETPAGL WEPIRTLHSE GFAILLDDGD PERDCYGWPA TSRLSAADHD       600
     RWQQSFDAAW RLILADHPGY APGLAAGLST VTPLRPAPAG RAKSATARQA PGAVGAALPD       660
     APELLALLLL HEFQHVKLGA VLDAYDLYDE SDRRRYYAPW RDDARPIEGL LQGTYAHLAV       720
     TDFWRVQRLR AVGEAAETAE VNFARWRLHT AEAIEVLAAS GSLTELGQQF TDSMRATVAP       780
     WLDEPVSSQA GQAARSSAER HLAAYLRRAG HASDV                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page