(data stored in ACNUC7421 zone)

EMBL: CP001700.PE504

CP001700.PE504       Location/Qualifiers
FT   CDS             596509..597360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0513"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   saq:Sare_2653 aminoglycoside N(3')- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69459"
FT                   /db_xref="GOA:C7PXA8"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA8"
FT                   /inference="protein motif:PRIAM:2.3.1.81"
FT                   /protein_id="ACU69459.1"
FT                   /translation="MSDSLEATHHAPIVRSRQQPCSRQQLAEDLVRLGLQSGTDALINS
FT                   SLRAIGPVDGGAATVLAALRAVLGPRATVVVPSQTPANSATSSAHREAVAGMTAVEIAG
FT                   YRERFPPFDPARTPSAGMGAFAEHVRLQPGACRSGHPTSSFAALGPAAERITALHPLHS
FT                   HLGPESPLGALAESGAQVLLLGVGFAKCTAFHLAEYRVRPETRTYSSKLADLSRPGGGG
FT                   RWIEYRAIRLDASDFDRLGADLAASRSWVRNGTVGAAPSACFPLASAVRFAEQWLSEHR
FT                   PG"
     MSDSLEATHH APIVRSRQQP CSRQQLAEDL VRLGLQSGTD ALINSSLRAI GPVDGGAATV        60
     LAALRAVLGP RATVVVPSQT PANSATSSAH REAVAGMTAV EIAGYRERFP PFDPARTPSA       120
     GMGAFAEHVR LQPGACRSGH PTSSFAALGP AAERITALHP LHSHLGPESP LGALAESGAQ       180
     VLLLGVGFAK CTAFHLAEYR VRPETRTYSS KLADLSRPGG GGRWIEYRAI RLDASDFDRL       240
     GADLAASRSW VRNGTVGAAP SACFPLASAV RFAEQWLSEH RPG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page