(data stored in ACNUC7421 zone)

EMBL: CP001700.PE505

CP001700.PE505       Location/Qualifiers
FT   CDS             597481..598845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69460"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA9"
FT                   /inference="similar to AA sequence:KEGG:SGR_5767"
FT                   /protein_id="ACU69460.1"
FT                   /translation="MSPSGPGEAESPRYSEYGSCFFLSYAHTPRVFDDGPDLNYWVRQF
FT                   FRDLCNELVSCDPTTWHRPTGPPGFMDDAIPEGALWRRVLARELATCRVFVPLYHRSYF
FT                   SSVNCGKEWAVFRARQMAQLAQTGVPNEAILPVVWKPPRSEDLPEFASALQMSRLSVSD
FT                   AYFERGLYELIRLDRDREYTNVVLRFAEWLDETARTCAPPLGPLADYELVRPLFPTDDS
FT                   GKGADRRFRITVAAPDEKSAPPGRSRDYYGPQPEDWRPYYPDSTVPLARRAEDVARGLG
FT                   YTPVVSALTRHSPEMRPRPRNPAAGAGAIPDAPGVLLVDPWIAHTPDSGSVAEVDRCHK
FT                   DWIRVLVPWSGTDRQTAEQAATLRSLLEGVMPWSMEEWHRTASAATRELASVADFGHAM
FT                   PDVMERAWRRYLRAVRPAGSGGREFPSRPRLRDGPDADADADGDAGASTDDGTED"
     MSPSGPGEAE SPRYSEYGSC FFLSYAHTPR VFDDGPDLNY WVRQFFRDLC NELVSCDPTT        60
     WHRPTGPPGF MDDAIPEGAL WRRVLARELA TCRVFVPLYH RSYFSSVNCG KEWAVFRARQ       120
     MAQLAQTGVP NEAILPVVWK PPRSEDLPEF ASALQMSRLS VSDAYFERGL YELIRLDRDR       180
     EYTNVVLRFA EWLDETARTC APPLGPLADY ELVRPLFPTD DSGKGADRRF RITVAAPDEK       240
     SAPPGRSRDY YGPQPEDWRP YYPDSTVPLA RRAEDVARGL GYTPVVSALT RHSPEMRPRP       300
     RNPAAGAGAI PDAPGVLLVD PWIAHTPDSG SVAEVDRCHK DWIRVLVPWS GTDRQTAEQA       360
     ATLRSLLEGV MPWSMEEWHR TASAATRELA SVADFGHAMP DVMERAWRRY LRAVRPAGSG       420
     GREFPSRPRL RDGPDADADA DGDAGASTDD GTED                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page