(data stored in ACNUC7421 zone)

EMBL: CP001700.PE506

CP001700.PE506       Location/Qualifiers
FT   CDS             598868..602812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0515"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: sgr:SGR_5768 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69461"
FT                   /db_xref="GOA:C7PXB0"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB0"
FT                   /inference="similar to AA sequence:KEGG:SGR_5768"
FT                   /protein_id="ACU69461.1"
FT                   /translation="MPEREGRVLTFYSYKGGCGRTMALANTAWILAANGRRVAVIDWDL
FT                   ESPGLHRYFPAPVLDPTALNGNLGVIDMVRDFEWAASRDEVPDPAQWYMDNARIRDLAI
FT                   SLRWPFPGGGCIHFVSAGLQNRAYSAAVGSLDWDRFYADLGGGRLFDAMRRDMIENYDY
FT                   TLIDSRTGFSDVADICTIHLPDVLVDCFTLNNQSIEGAAKVARSVHEHNRRRAIRILPV
FT                   PMRVDDGEKEKADAGRAAARARFEGFPQVDDPADAVRYWGAVEIPYRPFYAYEETLAVF
FT                   GDSPGLTTSLLAAYERLTGELTGGTVTSLPPIDDTRRISILDIVTRRRETVPEEVTVAY
FT                   IAEDRMWADWTAGVLRRSGVGASVRVLTPGIVTLPADGQRRRVLAIASTDFAGSGHALA
FT                   AARTLAGPEQLTAVLVSEPRADDRLGGLPSVDLHGLPEGPATARLLRALGKTDAEAVVS
FT                   GVTGEQTGGARFPAATPRVWSAPGRNATFTGRDAMLEKLRDGIVGSSSAVILPLALHGL
FT                   GGVGKTQLALEYAHRFKADYDLVWWIEAEQPDFIDTSLADLAIRLGLRGGDNVPEAAEA
FT                   AREALRRGTPYNRWLVVYDNALEPEVLTPYLPDLPGDGTGHILITSRIQSWSRVANSLE
FT                   VDVFTPEESVRHLTRAVPGLAQADAAAIAELVDNLPLAVESAASWLATTGTPVATYLES
FT                   LAEETTRVLSLGRPETYPVSLAVTWNLALQRLREREPAATRLLELAAFMNPDGIAMDLV
FT                   QSDEMVIALHPFNEFVTERMVIGNVVREIVVLSLIKVDPNTNALRMHRLVQEAVKATLD
FT                   DGSAQETIHEVHRILAGARPQFGDTDNPENWPRYQIIWPHLSPSRAIDCEEEPVRQLLI
FT                   DRVRFLWKTGDYAHALDFGRTLEKRWAERIEDYGSESTAGLALNRQFLNLRCQLATVLR
FT                   LRGEFRWAYDLDVEVLAEQQRVLPPRHPHTLLTAIGLAADLRGLGRFDDALEMDKATYA
FT                   DHKQAFWEDHPRALLSAHNLAVSYRLVGDFAQARAIDQDTLNRRKAVLGDRHPAALFSA
FT                   AHLARDLRETGHFEVSVELLRSTLADYRDVVGENAPETLRTAKSLAVSLRKADHLEEAL
FT                   ALSRDTYEHYLADYAPHNPDVLACAVNLAADFAATGDARSAVKIMDETLRAYRENLGRD
FT                   HPYTLVSLNNLGAFTRQAGIPDRARRHIKAAHGGFDAWLGPEHPYTLAAAANLTNSMVD
FT                   AGELEEAETMELAAAGIFEATLGADHPDTLAVSANRVATLKAMAREAEANTLRAGVMAA
FT                   LERTLGAEHGITRALAEGRRLDFDLEPQPT"
     MPEREGRVLT FYSYKGGCGR TMALANTAWI LAANGRRVAV IDWDLESPGL HRYFPAPVLD        60
     PTALNGNLGV IDMVRDFEWA ASRDEVPDPA QWYMDNARIR DLAISLRWPF PGGGCIHFVS       120
     AGLQNRAYSA AVGSLDWDRF YADLGGGRLF DAMRRDMIEN YDYTLIDSRT GFSDVADICT       180
     IHLPDVLVDC FTLNNQSIEG AAKVARSVHE HNRRRAIRIL PVPMRVDDGE KEKADAGRAA       240
     ARARFEGFPQ VDDPADAVRY WGAVEIPYRP FYAYEETLAV FGDSPGLTTS LLAAYERLTG       300
     ELTGGTVTSL PPIDDTRRIS ILDIVTRRRE TVPEEVTVAY IAEDRMWADW TAGVLRRSGV       360
     GASVRVLTPG IVTLPADGQR RRVLAIASTD FAGSGHALAA ARTLAGPEQL TAVLVSEPRA       420
     DDRLGGLPSV DLHGLPEGPA TARLLRALGK TDAEAVVSGV TGEQTGGARF PAATPRVWSA       480
     PGRNATFTGR DAMLEKLRDG IVGSSSAVIL PLALHGLGGV GKTQLALEYA HRFKADYDLV       540
     WWIEAEQPDF IDTSLADLAI RLGLRGGDNV PEAAEAAREA LRRGTPYNRW LVVYDNALEP       600
     EVLTPYLPDL PGDGTGHILI TSRIQSWSRV ANSLEVDVFT PEESVRHLTR AVPGLAQADA       660
     AAIAELVDNL PLAVESAASW LATTGTPVAT YLESLAEETT RVLSLGRPET YPVSLAVTWN       720
     LALQRLRERE PAATRLLELA AFMNPDGIAM DLVQSDEMVI ALHPFNEFVT ERMVIGNVVR       780
     EIVVLSLIKV DPNTNALRMH RLVQEAVKAT LDDGSAQETI HEVHRILAGA RPQFGDTDNP       840
     ENWPRYQIIW PHLSPSRAID CEEEPVRQLL IDRVRFLWKT GDYAHALDFG RTLEKRWAER       900
     IEDYGSESTA GLALNRQFLN LRCQLATVLR LRGEFRWAYD LDVEVLAEQQ RVLPPRHPHT       960
     LLTAIGLAAD LRGLGRFDDA LEMDKATYAD HKQAFWEDHP RALLSAHNLA VSYRLVGDFA      1020
     QARAIDQDTL NRRKAVLGDR HPAALFSAAH LARDLRETGH FEVSVELLRS TLADYRDVVG      1080
     ENAPETLRTA KSLAVSLRKA DHLEEALALS RDTYEHYLAD YAPHNPDVLA CAVNLAADFA      1140
     ATGDARSAVK IMDETLRAYR ENLGRDHPYT LVSLNNLGAF TRQAGIPDRA RRHIKAAHGG      1200
     FDAWLGPEHP YTLAAAANLT NSMVDAGELE EAETMELAAA GIFEATLGAD HPDTLAVSAN      1260
     RVATLKAMAR EAEANTLRAG VMAALERTLG AEHGITRALA EGRRLDFDLE PQPT            1314
//

If you have problems or comments...

PBIL Back to PBIL home page