(data stored in ACNUC7421 zone)

EMBL: CP001700.PE507

CP001700.PE507       Location/Qualifiers
FT   CDS             complement(602879..603754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0516"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sgr:SGR_5769 putative alpha/beta hydrolase fold protein
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69462"
FT                   /db_xref="GOA:C7PXB1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69462.1"
FT                   /translation="MTRIVQAQDGRKLAVEEWGAPDGAAVFLMHGTPGSRFGPRPRESV
FT                   LYRLGVRLIAYDRPGYGESDRLGARAVAHAAGDVAAIADALGLDRFAVLGRSGGGPHAL
FT                   ACACLLGDRVRCAAVLVGLAPRDAGGLDWYAGMTASNVAAYQTAESGARAIAARFEAQA
FT                   ALIRRDPAAHLPYRDRELSRSDQEVMADIGIRTMMLSNFAEAVKRSGVGWIDDALSFVA
FT                   AWGFDPARINVPVLLWHGARDVHAPVRHTIWLAERITDSHPVIVDDAAHFGALSAMPRV
FT                   LSWLVDGKRP"
     MTRIVQAQDG RKLAVEEWGA PDGAAVFLMH GTPGSRFGPR PRESVLYRLG VRLIAYDRPG        60
     YGESDRLGAR AVAHAAGDVA AIADALGLDR FAVLGRSGGG PHALACACLL GDRVRCAAVL       120
     VGLAPRDAGG LDWYAGMTAS NVAAYQTAES GARAIAARFE AQAALIRRDP AAHLPYRDRE       180
     LSRSDQEVMA DIGIRTMMLS NFAEAVKRSG VGWIDDALSF VAAWGFDPAR INVPVLLWHG       240
     ARDVHAPVRH TIWLAERITD SHPVIVDDAA HFGALSAMPR VLSWLVDGKR P                291
//

If you have problems or comments...

PBIL Back to PBIL home page