(data stored in ACNUC7421 zone)

EMBL: CP001700.PE509

CP001700.PE509       Location/Qualifiers
FT   CDS             complement(604946..605989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0519"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_3414 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69464"
FT                   /db_xref="GOA:C7PXB3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69464.1"
FT                   /translation="MVAALRLWRCRDDHKTIEILLLRHQLTILQRRLAAAGRRLRPDWA
FT                   DRAIIALLLGLVPKARRAGPCLFVTPDTILRWHRDLLRRRWAKKSRPKNDRRATHQNIK
FT                   TLIPRLARQNPAWGYRRIHGELAGLGIAIAASTVWEILKDAGVDPAPRRGSVTWASFLR
FT                   SQAEGIIAADFFTADLLDGTKVYVLTIIEHASRRIRVLGSTLHPTGQWTAQMARNLVMD
FT                   LDDAAATVKFLIRDRGTNFTEAFDTVLADAGIRTVLCNVQTPRMNAIMESWVGSVRRGL
FT                   LSRTLIWNHEHLRQILHHYELRHNTHRPHMSLSAAAPLKPLPPNITDLDALRVRRTRRA
FT                   GGVINEY"
     MVAALRLWRC RDDHKTIEIL LLRHQLTILQ RRLAAAGRRL RPDWADRAII ALLLGLVPKA        60
     RRAGPCLFVT PDTILRWHRD LLRRRWAKKS RPKNDRRATH QNIKTLIPRL ARQNPAWGYR       120
     RIHGELAGLG IAIAASTVWE ILKDAGVDPA PRRGSVTWAS FLRSQAEGII AADFFTADLL       180
     DGTKVYVLTI IEHASRRIRV LGSTLHPTGQ WTAQMARNLV MDLDDAAATV KFLIRDRGTN       240
     FTEAFDTVLA DAGIRTVLCN VQTPRMNAIM ESWVGSVRRG LLSRTLIWNH EHLRQILHHY       300
     ELRHNTHRPH MSLSAAAPLK PLPPNITDLD ALRVRRTRRA GGVINEY                     347
//

If you have problems or comments...

PBIL Back to PBIL home page