(data stored in ACNUC7421 zone)

EMBL: CP001700.PE51

CP001700.PE51        Location/Qualifiers
FT   CDS             complement(50483..51295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0051"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69006"
FT                   /db_xref="GOA:C7QFR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR7"
FT                   /inference="similar to AA sequence:KEGG:SCO3555"
FT                   /protein_id="ACU69006.1"
FT                   /translation="MNSALAGLLAASAVLAFPGPGARRRLETAVLGAPRGPKWRLRMAG
FT                   AWPTVLSAIALGVLSALLARSMVLAFLVPFGAWRAYRAWTAHTARLAVERRQTEIIELC
FT                   VTICSELHAGREAREALRDAAVGACPDLAVHLVGPLGTGDDVVTVLRTAAGTPGREALA
FT                   ALAACWQVAEGGAGMTAAIGELSDGLRAERAQRRELDAELAGIRTSARLLAMLPVVGLI
FT                   IGSGMGLSPIPMLLHTGVGETCLVLGIAFVLGGVMWMDRIARSAEALS"
     MNSALAGLLA ASAVLAFPGP GARRRLETAV LGAPRGPKWR LRMAGAWPTV LSAIALGVLS        60
     ALLARSMVLA FLVPFGAWRA YRAWTAHTAR LAVERRQTEI IELCVTICSE LHAGREAREA       120
     LRDAAVGACP DLAVHLVGPL GTGDDVVTVL RTAAGTPGRE ALAALAACWQ VAEGGAGMTA       180
     AIGELSDGLR AERAQRRELD AELAGIRTSA RLLAMLPVVG LIIGSGMGLS PIPMLLHTGV       240
     GETCLVLGIA FVLGGVMWMD RIARSAEALS                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page