(data stored in ACNUC7421 zone)

EMBL: CP001700.PE512

CP001700.PE512       Location/Qualifiers
FT   CDS             610077..610766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69467.1"
FT                   /translation="MRDRDTLGRMFLPEFRYAHYVSKDVENGEAMKLRRSVAVLVAACG
FT                   FSLASIAGAAAQVATPSTTPVALSHVLRGEEQLSLQQLLDIASHKVRGTYPNATLMLAD
FT                   GASPTGSTRNMDEVTDWRLIYNTNDAGSPVKSLELYATLEGEISHPVLRDQPWGGTVSI
FT                   PNQVGISPDLAYSILMDAGHNDPYQYVSLVKPLIANPHLQYHFSNIRGGCDGYAVNVDD
FT                   YAVNPIC"
     MRDRDTLGRM FLPEFRYAHY VSKDVENGEA MKLRRSVAVL VAACGFSLAS IAGAAAQVAT        60
     PSTTPVALSH VLRGEEQLSL QQLLDIASHK VRGTYPNATL MLADGASPTG STRNMDEVTD       120
     WRLIYNTNDA GSPVKSLELY ATLEGEISHP VLRDQPWGGT VSIPNQVGIS PDLAYSILMD       180
     AGHNDPYQYV SLVKPLIANP HLQYHFSNIR GGCDGYAVNV DDYAVNPIC                   229
//

If you have problems or comments...

PBIL Back to PBIL home page