(data stored in ACNUC7421 zone)

EMBL: CP001700.PE514

CP001700.PE514       Location/Qualifiers
FT   CDS             complement(611375..612217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0526"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sen:SACE_3708 abhydrolase, alpha/beta hydrolase fold
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69469"
FT                   /db_xref="GOA:C7PXB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69469.1"
FT                   /translation="MASGIRHVVVDADGVDIPVTLRGNGPLVLLLPGATGLQTGYAVLI
FT                   KLLSADHTVAVYDRRGHGRSKEKEPSTAPLSIEQHAMDAAVLIDALGEGPVHAVGSSAG
FT                   AVIGLDLLARYPDRVRSLIAHEPSLLPLIDDGPRWRTWYDDLVAIDREVGTRHAFDYFF
FT                   AHLASNGRGEQAPVAIPSSQLPEWSLYFQRELTEIVSYEPDLEQVALDRDAFVPVLGAD
FT                   SRERWHGRVVLELAARVGVPAVEVAGGHLAPVYEPAAFHRLIQDNVTLHEKLRASQLS"
     MASGIRHVVV DADGVDIPVT LRGNGPLVLL LPGATGLQTG YAVLIKLLSA DHTVAVYDRR        60
     GHGRSKEKEP STAPLSIEQH AMDAAVLIDA LGEGPVHAVG SSAGAVIGLD LLARYPDRVR       120
     SLIAHEPSLL PLIDDGPRWR TWYDDLVAID REVGTRHAFD YFFAHLASNG RGEQAPVAIP       180
     SSQLPEWSLY FQRELTEIVS YEPDLEQVAL DRDAFVPVLG ADSRERWHGR VVLELAARVG       240
     VPAVEVAGGH LAPVYEPAAF HRLIQDNVTL HEKLRASQLS                             280
//

If you have problems or comments...

PBIL Back to PBIL home page