(data stored in ACNUC7421 zone)

EMBL: CP001700.PE515

CP001700.PE515       Location/Qualifiers
FT   CDS             complement(612222..613028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0527"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: npu:Npun_F0780
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69470"
FT                   /db_xref="GOA:C7PXB9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB9"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ACU69470.1"
FT                   /translation="MTGAHSDKVGGGTVGGPRPAEPELRLFLFHHAGGSSSVFEGWESR
FT                   FPAGWDVRALDAPGRGAARSAKPCTTVEELAGYFRDHLSLSFDRPFSFFGHSMGAMVAY
FT                   ELARRLQAEGGPQPNWVGLSACRAPGQPAARGQHGLSNEDLRAWLAAAGGTDQLVLHHP
FT                   LIWKMLEPLLRADLRVVDSWQPTVDAVPLRGALSVFGAQDDRVLAHEKLIGWQPFTEHY
FT                   VASRLFRGGHFYLQRQADLIIRWIVADISGSRRVCATPWTSPAKTR"
     MTGAHSDKVG GGTVGGPRPA EPELRLFLFH HAGGSSSVFE GWESRFPAGW DVRALDAPGR        60
     GAARSAKPCT TVEELAGYFR DHLSLSFDRP FSFFGHSMGA MVAYELARRL QAEGGPQPNW       120
     VGLSACRAPG QPAARGQHGL SNEDLRAWLA AAGGTDQLVL HHPLIWKMLE PLLRADLRVV       180
     DSWQPTVDAV PLRGALSVFG AQDDRVLAHE KLIGWQPFTE HYVASRLFRG GHFYLQRQAD       240
     LIIRWIVADI SGSRRVCATP WTSPAKTR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page