(data stored in ACNUC7421 zone)

EMBL: CP001700.PE516

CP001700.PE516       Location/Qualifiers
FT   CDS             complement(613035..613835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0528"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU69471.1"
FT                   /translation="MNGAPDWITADADTERPSIARFYDYLLGGTHHLEVDRELGRKAIR
FT                   AAPGLILLMRENRKFLRRAVKCALDAGIDQFLDIGSGIPARGSIHETARKAGSRARVAY
FT                   VDIDPVAVSEGKAILAGDPEGVSVLGDVFEPAAILENPEVRALIDLDRPVVLLILNVIH
FT                   FFPDSKVLPVLETYRHRLVSGSMLGLSVAMDGTTGAEAIDELYRQEYEGFTLRSREQIE
FT                   ALFGDFELLEPGVVYPPEWRPEDPGRTVVNPERYSSLVGVARKR"
     MNGAPDWITA DADTERPSIA RFYDYLLGGT HHLEVDRELG RKAIRAAPGL ILLMRENRKF        60
     LRRAVKCALD AGIDQFLDIG SGIPARGSIH ETARKAGSRA RVAYVDIDPV AVSEGKAILA       120
     GDPEGVSVLG DVFEPAAILE NPEVRALIDL DRPVVLLILN VIHFFPDSKV LPVLETYRHR       180
     LVSGSMLGLS VAMDGTTGAE AIDELYRQEY EGFTLRSREQ IEALFGDFEL LEPGVVYPPE       240
     WRPEDPGRTV VNPERYSSLV GVARKR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page