(data stored in ACNUC7421 zone)

EMBL: CP001700.PE517

CP001700.PE517       Location/Qualifiers
FT   CDS             complement(613832..614464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0529"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mab:MAB_4054c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69472"
FT                   /db_xref="GOA:C7PXC1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACU69472.1"
FT                   /translation="MSKVYEKINHQMAGWIHRQPIFFVASAPLAASGRVNVSPKGLMGT
FT                   LVVLDPHSIAYLDYTGTGAETIAHLRENGRITVMFCAFEGRPKIVRLYGRGRYTVPGEP
FT                   EFDKLRELFEKTTTAGQRSIIIVDIDRITDSCGWSVPLMDYREDRAVLDLHNERRDDAY
FT                   FEKYWQTTNADSIDGLPALRSEPEPEPGLAPEPESEYLVVSASGSNE"
     MSKVYEKINH QMAGWIHRQP IFFVASAPLA ASGRVNVSPK GLMGTLVVLD PHSIAYLDYT        60
     GTGAETIAHL RENGRITVMF CAFEGRPKIV RLYGRGRYTV PGEPEFDKLR ELFEKTTTAG       120
     QRSIIIVDID RITDSCGWSV PLMDYREDRA VLDLHNERRD DAYFEKYWQT TNADSIDGLP       180
     ALRSEPEPEP GLAPEPESEY LVVSASGSNE                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page