(data stored in ACNUC7421 zone)

EMBL: CP001700.PE518

CP001700.PE518       Location/Qualifiers
FT   CDS             complement(614461..615936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0530"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: tryptophan halogenase; monooxygenase FAD-
FT                   binding; FAD dependent oxidoreductase; KEGG: fal:FRAAL4634
FT                   putative halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69473"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC2"
FT                   /inference="protein motif:PFAM:PF04820"
FT                   /protein_id="ACU69473.1"
FT                   /translation="MTEQNTVKTANDVDNPDNAEKTRVLVIGGGPGGSTAATLLARQGI
FT                   EVTLLESAIFPRYHIGESILPSVLPVLDLLGVREEVDNHGFVRKDGAYFEWGPENWDLN
FT                   FDHLSGASRHSYQVIRSEFDHMLLKNAQAKGVDVREGVKVTEILFHGDRPVAARWSASD
FT                   NSGAAGTIAFDFLVDASGRAGVMATKYLKNRRYHEAFKNVAVWSYWRDVKPLEVGPKGA
FT                   IAVCSVPYGWFWAIPLHDGTTSIGLVAKRTTFSDERERLGSIEAVYADAMTQAPRILEM
FT                   TQGANKIEGYKVEQDYSYVSERKSGPGYVLVGDAAAFLDPLLSTGVHLSTFSALLAAAS
FT                   VSAVLDGELAEQEAVDFYERAYHQAYERLLVVVSFFYNSYNRQTQFFEADKLTRRERHM
FT                   LNLYESFLHIVTGIEDLDDSIDGGEALEEVAQQIATQKKIDAGHNEAMNSLPDSPRQAV
FT                   GGLYLELEPRLRIRRTSEAPAGPEPVREARAGL"
     MTEQNTVKTA NDVDNPDNAE KTRVLVIGGG PGGSTAATLL ARQGIEVTLL ESAIFPRYHI        60
     GESILPSVLP VLDLLGVREE VDNHGFVRKD GAYFEWGPEN WDLNFDHLSG ASRHSYQVIR       120
     SEFDHMLLKN AQAKGVDVRE GVKVTEILFH GDRPVAARWS ASDNSGAAGT IAFDFLVDAS       180
     GRAGVMATKY LKNRRYHEAF KNVAVWSYWR DVKPLEVGPK GAIAVCSVPY GWFWAIPLHD       240
     GTTSIGLVAK RTTFSDERER LGSIEAVYAD AMTQAPRILE MTQGANKIEG YKVEQDYSYV       300
     SERKSGPGYV LVGDAAAFLD PLLSTGVHLS TFSALLAAAS VSAVLDGELA EQEAVDFYER       360
     AYHQAYERLL VVVSFFYNSY NRQTQFFEAD KLTRRERHML NLYESFLHIV TGIEDLDDSI       420
     DGGEALEEVA QQIATQKKID AGHNEAMNSL PDSPRQAVGG LYLELEPRLR IRRTSEAPAG       480
     PEPVREARAG L                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page