(data stored in ACNUC7421 zone)

EMBL: CP001700.PE519

CP001700.PE519       Location/Qualifiers
FT   CDS             complement(615936..616739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0531"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   hch:HCH_01667 phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69474"
FT                   /db_xref="GOA:C7PXC3"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC3"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACU69474.1"
FT                   /translation="MTAARDPLGVDRADREHRHGDRAVARRPHPADALLRSVRRPRITS
FT                   FGRRIDVWVAAIRPDVDPDPDMPVLRAFLPEGELRRLSAIRHDAARVEYAAGRLLVRSV
FT                   LAERLRTPPTRLRIGEEPGGRPRLEPGPGGSPADDFNLSHSGGRLALSVSRNLRVGVDI
FT                   ERVDRTRPLEALARRYYTADEHALLNTYAGADAYAECWYRIWTTKEAHAKARGAGVRGM
FT                   TDPLDGHGTRWRRYPIPVAPGFAGSVVALHPSYLSVPHRLLGSDD"
     MTAARDPLGV DRADREHRHG DRAVARRPHP ADALLRSVRR PRITSFGRRI DVWVAAIRPD        60
     VDPDPDMPVL RAFLPEGELR RLSAIRHDAA RVEYAAGRLL VRSVLAERLR TPPTRLRIGE       120
     EPGGRPRLEP GPGGSPADDF NLSHSGGRLA LSVSRNLRVG VDIERVDRTR PLEALARRYY       180
     TADEHALLNT YAGADAYAEC WYRIWTTKEA HAKARGAGVR GMTDPLDGHG TRWRRYPIPV       240
     APGFAGSVVA LHPSYLSVPH RLLGSDD                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page