(data stored in ACNUC7421 zone)

EMBL: CP001700.PE52

CP001700.PE52        Location/Qualifiers
FT   CDS             complement(51292..52770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0052"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sco:SCO3556 secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69007"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU69007.1"
FT                   /translation="MNALSSSPMSMPSPMSSPSPMSSPSPLSPVPLPGAERLRLNAALV
FT                   DRVRTRLATPPVRVDMQAILAALRAEGCMLDGRDLRAAAYQVRSELTGAGVLDRYLADP
FT                   EVTDVLVNAPDSVWIERAGTLSRADVRFPDEAAVRRLAQRLAAHAGRRLDDAAPCVDGI
FT                   LPDGARLHAVLPPIAARGTLISLRVPPRRAFTVDQLTAGGLTTEHGARLLRAVASEKVS
FT                   YLVTGGTGSGKTTLLGALLGLVPGDERIVITEECTEVVVDHPHVARLQCRIANQENRGA
FT                   VNLRTLVRQALRMRPDRVVVGEVRGPEVLELLAAMNTGHDGCAATMHANGVEDVVARVE
FT                   ALAAPAGMERSALHAQLNSAVQVVVHLVRDKGKRRLASIGVIDRGFGETEVLPAVDFDD
FT                   TGKATYGPGSDRLSFLLGFEVRESTDEAPKAKPPPPRLPVDDLEKLAGWEEALAVADRL
FT                   LPVLKNAANGGDSHVDEPFVADYGPSPTRRGGHR"
     MNALSSSPMS MPSPMSSPSP MSSPSPLSPV PLPGAERLRL NAALVDRVRT RLATPPVRVD        60
     MQAILAALRA EGCMLDGRDL RAAAYQVRSE LTGAGVLDRY LADPEVTDVL VNAPDSVWIE       120
     RAGTLSRADV RFPDEAAVRR LAQRLAAHAG RRLDDAAPCV DGILPDGARL HAVLPPIAAR       180
     GTLISLRVPP RRAFTVDQLT AGGLTTEHGA RLLRAVASEK VSYLVTGGTG SGKTTLLGAL       240
     LGLVPGDERI VITEECTEVV VDHPHVARLQ CRIANQENRG AVNLRTLVRQ ALRMRPDRVV       300
     VGEVRGPEVL ELLAAMNTGH DGCAATMHAN GVEDVVARVE ALAAPAGMER SALHAQLNSA       360
     VQVVVHLVRD KGKRRLASIG VIDRGFGETE VLPAVDFDDT GKATYGPGSD RLSFLLGFEV       420
     RESTDEAPKA KPPPPRLPVD DLEKLAGWEE ALAVADRLLP VLKNAANGGD SHVDEPFVAD       480
     YGPSPTRRGG HR                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page