(data stored in ACNUC7421 zone)

EMBL: CP001700.PE520

CP001700.PE520       Location/Qualifiers
FT   CDS             complement(616736..617584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0532"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   sgr:SGR_5183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69475"
FT                   /db_xref="GOA:C7PXC4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC4"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACU69475.1"
FT                   /translation="MANKTESAGTDRGLAVLRARDLELRDAIDAVVLSWAAEAGAARTA
FT                   YPPLLRTSDLAALDYWVNFPHLALLAVGADAGREKELAAADHSVIAPELLAPAEYALPS
FT                   AACYSAYLDLSGTRLDGAHKITTVATCFRRENHFEGLRRLLSFTMREVVCVGNREAVLE
FT                   HASSFKKRVGEFARRLGLPLEVQAATDPFFEKDAARTLMQQLFPVKEEFVFGGGLAIAS
FT                   VNFHRNFFGERCDIRLADGSPAFTSCVAFGLERWLAALTERFGRDDPALPERIAEAARW
FT                   T"
     MANKTESAGT DRGLAVLRAR DLELRDAIDA VVLSWAAEAG AARTAYPPLL RTSDLAALDY        60
     WVNFPHLALL AVGADAGREK ELAAADHSVI APELLAPAEY ALPSAACYSA YLDLSGTRLD       120
     GAHKITTVAT CFRRENHFEG LRRLLSFTMR EVVCVGNREA VLEHASSFKK RVGEFARRLG       180
     LPLEVQAATD PFFEKDAART LMQQLFPVKE EFVFGGGLAI ASVNFHRNFF GERCDIRLAD       240
     GSPAFTSCVA FGLERWLAAL TERFGRDDPA LPERIAEAAR WT                          282
//

If you have problems or comments...

PBIL Back to PBIL home page