(data stored in ACNUC7421 zone)

EMBL: CP001700.PE522

CP001700.PE522       Location/Qualifiers
FT   CDS             complement(617855..618796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69477"
FT                   /db_xref="GOA:C7PXC6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC6"
FT                   /inference="similar to AA sequence:KEGG:Sden_1069"
FT                   /protein_id="ACU69477.1"
FT                   /translation="MTDSLTTTTSNAHAYLAALPDILGGDERFKTVLDRLTVMSERDYY
FT                   DPYKLFVWPESIPEDGYWMTPELMSVHGTEAGASLEQAQLRALSKWESVTFYSLNVHGI
FT                   RELLTSIVARIHMPGFEVASEYFHHIIGEENDHMWFFAKFCLLYAGKVYPDRSLSFAGP
FT                   GIPEADTFLLFARLLIFEELVDVFNQRMGEDQRLAPTIRKINSVHHQDESRHIAFGRQI
FT                   VALLHRDLRTRLDTAQLAELERYLKAYMRASVESLCNPAAFRDAGIPEPFAVRRAVIED
FT                   PAFQEHAARILKRSTSHMVSEGIFTDERTVAA"
     MTDSLTTTTS NAHAYLAALP DILGGDERFK TVLDRLTVMS ERDYYDPYKL FVWPESIPED        60
     GYWMTPELMS VHGTEAGASL EQAQLRALSK WESVTFYSLN VHGIRELLTS IVARIHMPGF       120
     EVASEYFHHI IGEENDHMWF FAKFCLLYAG KVYPDRSLSF AGPGIPEADT FLLFARLLIF       180
     EELVDVFNQR MGEDQRLAPT IRKINSVHHQ DESRHIAFGR QIVALLHRDL RTRLDTAQLA       240
     ELERYLKAYM RASVESLCNP AAFRDAGIPE PFAVRRAVIE DPAFQEHAAR ILKRSTSHMV       300
     SEGIFTDERT VAA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page