(data stored in ACNUC7421 zone)

EMBL: CP001700.PE523

CP001700.PE523       Location/Qualifiers
FT   CDS             complement(618793..619875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3280 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69478"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69478.1"
FT                   /translation="MTAAAPEAGVREADRWLDALERTYLVPEDHRVGYFDRVAALDMLR
FT                   CGEEVLEELVKAGLPTLGESGAEWFDRFDLFNLALASGSQISVPEKAIKYALRWMHRGP
FT                   RTWTERLDWTFVVDLSCPLDTCGADPEWSHAQMLPEAVGGELYDWKVEPEGARMVGDQL
FT                   RYSGPGPLRFSGNVSTSGELMELRSPVLRKIIEDFFAVGYRWVRLPEPLQWEYQRLLDA
FT                   GVSPCISASLFLAREFEAAGYPAITRRGWLLGMLDLSHSWVEVTDDDGVVKPIDPIFTW
FT                   LTEYADKPHPDLAAASIGSRMNRLLPAAMAADGLMATHRCGGRDVTPRRKTMIRRRLST
FT                   DGPAGSAGAAGTASTAGVSL"
     MTAAAPEAGV READRWLDAL ERTYLVPEDH RVGYFDRVAA LDMLRCGEEV LEELVKAGLP        60
     TLGESGAEWF DRFDLFNLAL ASGSQISVPE KAIKYALRWM HRGPRTWTER LDWTFVVDLS       120
     CPLDTCGADP EWSHAQMLPE AVGGELYDWK VEPEGARMVG DQLRYSGPGP LRFSGNVSTS       180
     GELMELRSPV LRKIIEDFFA VGYRWVRLPE PLQWEYQRLL DAGVSPCISA SLFLAREFEA       240
     AGYPAITRRG WLLGMLDLSH SWVEVTDDDG VVKPIDPIFT WLTEYADKPH PDLAAASIGS       300
     RMNRLLPAAM AADGLMATHR CGGRDVTPRR KTMIRRRLST DGPAGSAGAA GTASTAGVSL       360
//

If you have problems or comments...

PBIL Back to PBIL home page