(data stored in ACNUC7421 zone)

EMBL: CP001700.PE524

CP001700.PE524       Location/Qualifiers
FT   CDS             complement(619872..620138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0536"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: tte:TTE1471 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69479"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC8"
FT                   /inference="similar to AA sequence:KEGG:TTE1471"
FT                   /protein_id="ACU69479.1"
FT                   /translation="MQLYEQTVVRVQEIIGDMSPAKPETAGPELILIDDLGYDSIHFLE
FT                   LALALEAEFNLFEFDEEQAVGMITVGDVAHLIAKIVVAAEDPT"
     MQLYEQTVVR VQEIIGDMSP AKPETAGPEL ILIDDLGYDS IHFLELALAL EAEFNLFEFD        60
     EEQAVGMITV GDVAHLIAKI VVAAEDPT                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page