(data stored in ACNUC7421 zone)

EMBL: CP001700.PE525

CP001700.PE525       Location/Qualifiers
FT   CDS             complement(620305..621366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_3331 ribonucleotide-diphosphate
FT                   reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69480"
FT                   /db_xref="GOA:C7PXC9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69480.1"
FT                   /translation="MSGGASTGTDGGSAQEGTAGSDTEGHAHDAHDEVGPPGRDGLRSL
FT                   PGSADLYNRWESRQWSVAGLDLARDRRRFAELRPFARREILSALAELEIGESCVTRTLS
FT                   ALADHAPDEADRLYLCTQMADEARHVRFFQSYLSDVAGIAAEQLEPHGAMGGESGFGVV
FT                   YDPLLTRHTAAVRTRPDDRRVWHVAVVSYHLLAEGLLAVAGLRALRALAKSCELTALSE
FT                   GLANVVRDEARHVTFGLAATRRGAQSGYADAIGEAYLDGLGAATRVLVNPARRAASPVL
FT                   PTALRAYAGNLAAEWSAANARMCRHVEVVGLAALDTSANLCWSSGLDAAFAEYRERWGA
FT                   HHPVARARQLGLV"
     MSGGASTGTD GGSAQEGTAG SDTEGHAHDA HDEVGPPGRD GLRSLPGSAD LYNRWESRQW        60
     SVAGLDLARD RRRFAELRPF ARREILSALA ELEIGESCVT RTLSALADHA PDEADRLYLC       120
     TQMADEARHV RFFQSYLSDV AGIAAEQLEP HGAMGGESGF GVVYDPLLTR HTAAVRTRPD       180
     DRRVWHVAVV SYHLLAEGLL AVAGLRALRA LAKSCELTAL SEGLANVVRD EARHVTFGLA       240
     ATRRGAQSGY ADAIGEAYLD GLGAATRVLV NPARRAASPV LPTALRAYAG NLAAEWSAAN       300
     ARMCRHVEVV GLAALDTSAN LCWSSGLDAA FAEYRERWGA HHPVARARQL GLV              353
//

If you have problems or comments...

PBIL Back to PBIL home page