(data stored in ACNUC7421 zone)

EMBL: CP001700.PE526

CP001700.PE526       Location/Qualifiers
FT   CDS             complement(621366..623102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0538"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_3010 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69481"
FT                   /db_xref="GOA:C7PXD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69481.1"
FT                   /translation="MLLNWLLMPNTETGLCILGRDGDWRRHSYADIAAAVRRAIWLLRD
FT                   RDVCAEDRVAIVLADPLHFVTAFMAALAVGAVPVPLAPPTALREADRYVAHVAETLRVA
FT                   RPDLVCTGAGHRAEVLAALAAAGCPAGVVDIADAAHVPADSGDPYRRKPSDSALLQFTS
FT                   GSSGTPKGVRVSWANLTANIAAIRSWMRWEDDDVFASWLPLHHDMGLVGALITSFAAGT
FT                   DLWLMTPRQFVRTPARWLECFGVHGATITTSPSFGYAHVAARVRAGELDGMDFSRWRVA
FT                   ILGAERIDPAAVADFQALVGRRGFDTSSLMGAYGLAEGTLLATGVPARAGSRLVKVVDW
FT                   ALTAGSPVAISQEGRLGRDAVQGAGWLASCGRAADGVAVTVVDDAGDEVPDGTFGEIRL
FT                   SGDSLAAGYLTRDGSVPFSARGSAADAPGADPVLDTGDAGFLLDGELYVVGRIGDALRV
FT                   HGHGVYAEDVEAELSRLGGEQGPAAYAAVFGTIGTRDLAAVFVEGDPPRTWSAKAEQRI
FT                   RTAASTDLPVLIFQGSKGSIARTSSGKPRRRHLWLRLLDGGVPDGWRLVHGEWPWPAGE
FT                   QS"
     MLLNWLLMPN TETGLCILGR DGDWRRHSYA DIAAAVRRAI WLLRDRDVCA EDRVAIVLAD        60
     PLHFVTAFMA ALAVGAVPVP LAPPTALREA DRYVAHVAET LRVARPDLVC TGAGHRAEVL       120
     AALAAAGCPA GVVDIADAAH VPADSGDPYR RKPSDSALLQ FTSGSSGTPK GVRVSWANLT       180
     ANIAAIRSWM RWEDDDVFAS WLPLHHDMGL VGALITSFAA GTDLWLMTPR QFVRTPARWL       240
     ECFGVHGATI TTSPSFGYAH VAARVRAGEL DGMDFSRWRV AILGAERIDP AAVADFQALV       300
     GRRGFDTSSL MGAYGLAEGT LLATGVPARA GSRLVKVVDW ALTAGSPVAI SQEGRLGRDA       360
     VQGAGWLASC GRAADGVAVT VVDDAGDEVP DGTFGEIRLS GDSLAAGYLT RDGSVPFSAR       420
     GSAADAPGAD PVLDTGDAGF LLDGELYVVG RIGDALRVHG HGVYAEDVEA ELSRLGGEQG       480
     PAAYAAVFGT IGTRDLAAVF VEGDPPRTWS AKAEQRIRTA ASTDLPVLIF QGSKGSIART       540
     SSGKPRRRHL WLRLLDGGVP DGWRLVHGEW PWPAGEQS                               578
//

If you have problems or comments...

PBIL Back to PBIL home page