(data stored in ACNUC7421 zone)

EMBL: CP001700.PE527

CP001700.PE527       Location/Qualifiers
FT   CDS             complement(623267..624508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0539"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kpe:KPK_1427 transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69482"
FT                   /db_xref="GOA:C7PXD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69482.1"
FT                   /translation="MASSEQGKHVTQVQPPPVRRLWSAVFFGYLALGATLQELPGYMTS
FT                   KFGDGPTIIGVAVGIAYLGTAVTRPFAGRAGDAGLARNVSVAGGAITTLAALGQLTAPS
FT                   ALVLIIFRLLMGIGEGALFSGCLPWVLTGIAADRRGRIAGWFGLSMWGGLALGPLAAVG
FT                   VNHLGGSTATWWTIFGLPLVSSVLIASTRPQPAVSPRREIRPQGWRDIVPIGVSVPGIV
FT                   LGLAAYGYGTLNALLVLYLTHDHIGGQGIGLTVFAVAFLATRAAGSPLTDQYGGIRVAR
FT                   VTLVVEIAGLCVLAASSSQGGALAGCVVTGIGLGVIYPSTSKITLGRTGPLQAGVSMGT
FT                   MTSFWDLGIMAAGPISGAVAAHLGYREGFGVAAAVTVAALVLTVLGLHTDSPAEAPTSV
FT                   PRSVPAGAQVRPRA"
     MASSEQGKHV TQVQPPPVRR LWSAVFFGYL ALGATLQELP GYMTSKFGDG PTIIGVAVGI        60
     AYLGTAVTRP FAGRAGDAGL ARNVSVAGGA ITTLAALGQL TAPSALVLII FRLLMGIGEG       120
     ALFSGCLPWV LTGIAADRRG RIAGWFGLSM WGGLALGPLA AVGVNHLGGS TATWWTIFGL       180
     PLVSSVLIAS TRPQPAVSPR REIRPQGWRD IVPIGVSVPG IVLGLAAYGY GTLNALLVLY       240
     LTHDHIGGQG IGLTVFAVAF LATRAAGSPL TDQYGGIRVA RVTLVVEIAG LCVLAASSSQ       300
     GGALAGCVVT GIGLGVIYPS TSKITLGRTG PLQAGVSMGT MTSFWDLGIM AAGPISGAVA       360
     AHLGYREGFG VAAAVTVAAL VLTVLGLHTD SPAEAPTSVP RSVPAGAQVR PRA              413
//

If you have problems or comments...

PBIL Back to PBIL home page