(data stored in ACNUC7421 zone)

EMBL: CP001700.PE528

CP001700.PE528       Location/Qualifiers
FT   CDS             624618..625493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sen:SACE_1630 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69483"
FT                   /db_xref="GOA:C7PXD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69483.1"
FT                   /translation="MLDVNRLRLLRELSHRGTIAAVAEALSFTPSAVSQQLSTLEREAG
FT                   VALLARTGRRVTLTPAGQNLVEHTESVLEHLARAEAELARVRAGLAGPVRIGSYPSAAR
FT                   TLFPAVLTLLARSHPMLEPQITELDPAEVPSALRAGDVDMALVHEYDFVPATSDPGLNS
FT                   EALFTEPLYLAAPEQGTIADHRDSSWIVSPAGTMCRSSTERACQAAGFSPRVRHEIDDF
FT                   ATAMVLAALGQGVTLVPHLAALAPPEGLTLTRQSMSRRTRIAYRAGTAGHPAVAAVTSA
FT                   LREAVPTDLS"
     MLDVNRLRLL RELSHRGTIA AVAEALSFTP SAVSQQLSTL EREAGVALLA RTGRRVTLTP        60
     AGQNLVEHTE SVLEHLARAE AELARVRAGL AGPVRIGSYP SAARTLFPAV LTLLARSHPM       120
     LEPQITELDP AEVPSALRAG DVDMALVHEY DFVPATSDPG LNSEALFTEP LYLAAPEQGT       180
     IADHRDSSWI VSPAGTMCRS STERACQAAG FSPRVRHEID DFATAMVLAA LGQGVTLVPH       240
     LAALAPPEGL TLTRQSMSRR TRIAYRAGTA GHPAVAAVTS ALREAVPTDL S                291
//

If you have problems or comments...

PBIL Back to PBIL home page