(data stored in ACNUC7421 zone)

EMBL: CP001700.PE529

CP001700.PE529       Location/Qualifiers
FT   CDS             630102..631304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0546"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afe:Lferr_0188 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69484"
FT                   /db_xref="GOA:C7PXD3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD3"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU69484.1"
FT                   /translation="MTLRTSPPHPGLAGGPVYLDYNATTPVDPRVADAMVPHLTYLFGN
FT                   PSSSHAYGAGPRTAMQRARGQVAAVIGARSEGEIVFTGSGSEADLLALRGAVLAAGGPR
FT                   PHVITQVTEHPAVLETCSALERLHGAQVTVLPVDGYGMLEPSTLAAALERPTALVSVMA
FT                   ANNETGALQPIAELAALAHARGALFHCDAAQAVGKIALDVRALGVDLLTIVGHKMYAPK
FT                   GVAALYVREGVRLEPVVYGGGQERALRSGTESVALAVALGAAAELVVEDLAHNEPARVA
FT                   ALRDELHRLLTAGWPGRVRLNGPDAARLPNTLNVSIDGVRGYEMLASVPDVAASTGSAC
FT                   HSGDHTTPSAVLTAMGFDEDRALGSVRLSLGRWSTRREVEKAARALIGHKLPNRDEAPP
FT                   R"
     MTLRTSPPHP GLAGGPVYLD YNATTPVDPR VADAMVPHLT YLFGNPSSSH AYGAGPRTAM        60
     QRARGQVAAV IGARSEGEIV FTGSGSEADL LALRGAVLAA GGPRPHVITQ VTEHPAVLET       120
     CSALERLHGA QVTVLPVDGY GMLEPSTLAA ALERPTALVS VMAANNETGA LQPIAELAAL       180
     AHARGALFHC DAAQAVGKIA LDVRALGVDL LTIVGHKMYA PKGVAALYVR EGVRLEPVVY       240
     GGGQERALRS GTESVALAVA LGAAAELVVE DLAHNEPARV AALRDELHRL LTAGWPGRVR       300
     LNGPDAARLP NTLNVSIDGV RGYEMLASVP DVAASTGSAC HSGDHTTPSA VLTAMGFDED       360
     RALGSVRLSL GRWSTRREVE KAARALIGHK LPNRDEAPPR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page