(data stored in ACNUC7421 zone)

EMBL: CP001700.PE53

CP001700.PE53        Location/Qualifiers
FT   CDS             complement(52767..54476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0129 putative septum site determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69008"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69008.1"
FT                   /translation="MRDLTQHPVPGRPGRPRRPDPAPPPGRGPAPAAAPLAVTADPALA
FT                   DALLRVAAEAGVRIEIVPGPSAARHRWSAAPLVLIGVDQTGEVARAGLPHRPDVALIGR
FT                   DLDDASVWQRGSAVGAAHVLILPDCERWLAGMLAEADSPREEPGAVVAVLSGRGGAGGS
FT                   TLAAALALAGVRRGLRSTLVDLDPAGGGIDLLFGLETEPGPRWSELAQWRDGRLSGRSL
FT                   RDALPTYAAHSRHGLAAGLGLAEEGADRLPVLAWPRARPGEDDGPGWLGARPTVAEDPW
FT                   YDSGAPADPGKADPWLPQDSAPSGGDIAAGSANPLYGAGSPDIAEDLWSGGGSSRRQET
FT                   VGPRTGGGRFNADGSSAESLSRTRLIALENSDSEVSTEVDDGSRDRDRVADAARATARP
FT                   QHGLPILTYPHTRADLPLPAVAAEPVRAVLTALAQAGDLVVVDLPRSLDEAATEALALA
FT                   NVTLMLVPAEVRASAAASQLAAAVRLVSPDLRVVVRLPAPGGLEPLDITDVMGGLPLAG
FT                   VIGADRRLSAAAEHGEPPGSSARGTVSAFCRTFLDDLFGVASGRRSESRAAA"
     MRDLTQHPVP GRPGRPRRPD PAPPPGRGPA PAAAPLAVTA DPALADALLR VAAEAGVRIE        60
     IVPGPSAARH RWSAAPLVLI GVDQTGEVAR AGLPHRPDVA LIGRDLDDAS VWQRGSAVGA       120
     AHVLILPDCE RWLAGMLAEA DSPREEPGAV VAVLSGRGGA GGSTLAAALA LAGVRRGLRS       180
     TLVDLDPAGG GIDLLFGLET EPGPRWSELA QWRDGRLSGR SLRDALPTYA AHSRHGLAAG       240
     LGLAEEGADR LPVLAWPRAR PGEDDGPGWL GARPTVAEDP WYDSGAPADP GKADPWLPQD       300
     SAPSGGDIAA GSANPLYGAG SPDIAEDLWS GGGSSRRQET VGPRTGGGRF NADGSSAESL       360
     SRTRLIALEN SDSEVSTEVD DGSRDRDRVA DAARATARPQ HGLPILTYPH TRADLPLPAV       420
     AAEPVRAVLT ALAQAGDLVV VDLPRSLDEA ATEALALANV TLMLVPAEVR ASAAASQLAA       480
     AVRLVSPDLR VVVRLPAPGG LEPLDITDVM GGLPLAGVIG ADRRLSAAAE HGEPPGSSAR       540
     GTVSAFCRTF LDDLFGVASG RRSESRAAA                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page