(data stored in ACNUC7421 zone)

EMBL: CP001700.PE530

CP001700.PE530       Location/Qualifiers
FT   CDS             631695..633119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0547"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="KEGG: tfu:Tfu_0795 hypothetical protein; TIGRFAM:
FT                   MiaB-like tRNA modifying enzyme YliG; RNA modification
FT                   enzyme, MiaB family; PFAM: Protein of unknown function
FT                   UPF0004; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69485"
FT                   /db_xref="GOA:C7PXD4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD4"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACU69485.1"
FT                   /translation="MAASRGTVSLVTLGCGRNEVDSEELAARLESAGWELADPDSVPGE
FT                   SDIIVVNTCGFIESAKKTSLETLVAASNAEAKVVAVGCVAERYGKRLAEALPEVDAVLS
FT                   FDDYPDISQRLDDVVRGKKHESHTPRDRRRLLPIAPVDRANNSSVVAPGHGIVRQDSEA
FT                   GLGGSIFLRKRLGGGGPLGDGVVAPLKLASGCDRRCSFCAIPSFRGAFISRTPDDIVAE
FT                   AEWLADAGVRELILVSENSTSYGKDFGDLQALEKLLPRLTSLVSRVRISYLQPAELRPT
FT                   LIEAIGGIPGVASYFDLSFQHASGPVLRRMRRFGDRERFLELLDKIRVIAPEAGMRSNF
FT                   IVGFPGETEDDYGEVERFVSEARLDAVGVFGYSDEEGTEALGLPDKVEQSQIADRVARL
FT                   TVISRKAMDDRAAERVGSEIEVIVKHPGRGWAAHQAPAVDGFVTLTGSSSEAGDVLRAR
FT                   VTGQDGANLIAEALAK"
     MAASRGTVSL VTLGCGRNEV DSEELAARLE SAGWELADPD SVPGESDIIV VNTCGFIESA        60
     KKTSLETLVA ASNAEAKVVA VGCVAERYGK RLAEALPEVD AVLSFDDYPD ISQRLDDVVR       120
     GKKHESHTPR DRRRLLPIAP VDRANNSSVV APGHGIVRQD SEAGLGGSIF LRKRLGGGGP       180
     LGDGVVAPLK LASGCDRRCS FCAIPSFRGA FISRTPDDIV AEAEWLADAG VRELILVSEN       240
     STSYGKDFGD LQALEKLLPR LTSLVSRVRI SYLQPAELRP TLIEAIGGIP GVASYFDLSF       300
     QHASGPVLRR MRRFGDRERF LELLDKIRVI APEAGMRSNF IVGFPGETED DYGEVERFVS       360
     EARLDAVGVF GYSDEEGTEA LGLPDKVEQS QIADRVARLT VISRKAMDDR AAERVGSEIE       420
     VIVKHPGRGW AAHQAPAVDG FVTLTGSSSE AGDVLRARVT GQDGANLIAE ALAK             474
//

If you have problems or comments...

PBIL Back to PBIL home page