(data stored in ACNUC7421 zone)

EMBL: CP001700.PE531

CP001700.PE531       Location/Qualifiers
FT   CDS             633147..634406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_2123 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69486"
FT                   /db_xref="GOA:C7PXD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69486.1"
FT                   /translation="MTAQAIVSDQRQSNYRQVFAIREFRYVFTAHSASMLGSVVTDVSL
FT                   SVLVLERTGSPFLAALTFALGFMPYAFAGTLLAGIGDRYPARLLLVTCNCVSAATVAVM
FT                   AMPFTPIWALIVLRFAASTIQPIFTSARAASLPEFLKGDRYTLGRSILRIVNQSTQIIG
FT                   YATGGLLLLVIQPRQALWIDAASFAVSAVLLRVGTVGRPARITDRKAQGTLIRESLSGA
FT                   RAVVRQPRIRALLFLWWTAPALAGIPEGLAAPYVRQIHAASVSVGLLMASAAVGTIGGE
FT                   VAIGTLVGPARRMRLVVPLASCSLLPLAVFVLRPDVIVAIALMGLTGVADAYMLGLDQW
FT                   FLEAVPDELRAQAFSIMFAGIMLTQGLTISIGGLAAEFAAPSLVIAISAAVGTVVIALV
FT                   CRSVLRTAPSPSSEESISVG"
     MTAQAIVSDQ RQSNYRQVFA IREFRYVFTA HSASMLGSVV TDVSLSVLVL ERTGSPFLAA        60
     LTFALGFMPY AFAGTLLAGI GDRYPARLLL VTCNCVSAAT VAVMAMPFTP IWALIVLRFA       120
     ASTIQPIFTS ARAASLPEFL KGDRYTLGRS ILRIVNQSTQ IIGYATGGLL LLVIQPRQAL       180
     WIDAASFAVS AVLLRVGTVG RPARITDRKA QGTLIRESLS GARAVVRQPR IRALLFLWWT       240
     APALAGIPEG LAAPYVRQIH AASVSVGLLM ASAAVGTIGG EVAIGTLVGP ARRMRLVVPL       300
     ASCSLLPLAV FVLRPDVIVA IALMGLTGVA DAYMLGLDQW FLEAVPDELR AQAFSIMFAG       360
     IMLTQGLTIS IGGLAAEFAA PSLVIAISAA VGTVVIALVC RSVLRTAPSP SSEESISVG        419
//

If you have problems or comments...

PBIL Back to PBIL home page